SecReT6
Effector Protein ID: 186470897
-
SecReT6 ID275
T6SS typeA3
Gene symbol-
Locus tagBphy_6112
StrainBurkholderia phymatum STM815
Repliconplasmid pBPHY01 [GenBank: NC_010625] [Browse all T6SS(s) in this replicon]
Location [Strand]663139..663624 [-]
ProductHcp1 family type VI secretion system effector
Effector typeProtein
Homologous effectorSciK
DescriptionHcp protein
UniProt IDB2JW42
KEGG IDbph:Bphy_6112
PDB IDNA
Domain hit(s) vs Pfam DUF796 [PF05638], Evalue: 1.30E-43, Aligned region: 6..136
Protein Sequence: 161 a.a.     [Download]
>gi|186470897|ref|YP_001862215.1| unnamed protein product [Burkholderia phymatum STM815]
MAQDIFLKIDGIDGESQDDKHKNEIEVLNWNWEISQESSMHSGSGGGAGKATVGDLWFQHGIDRASPNLM
KYALTGKHIDQAVLVMRKAGGNPLEYLKITMSDVLVTRVKPSGSKNGEEKSLEEVSLSFAKVKQEYVVQN
AQGGSGGAVTASYDIKGNKEA
-
Nucleotide Sequence: 486 bp     [Download]
>gi|186470346|ref|NC_010625.1|:c663624-663139 Burkholderia phymatum STM815 plasmid pBPHY01, complete sequence
ATGGCACAGGATATTTTCCTGAAGATTGATGGCATCGACGGTGAGTCGCAGGACGACAAGCACAAGAACG
AGATCGAAGTACTGAACTGGAACTGGGAAATCAGCCAGGAATCGTCGATGCATTCGGGCAGCGGCGGCGG
CGCCGGCAAGGCGACGGTTGGCGACCTGTGGTTCCAGCACGGCATCGACCGTGCGAGCCCGAACCTCATG
AAGTACGCGCTCACGGGCAAGCACATCGACCAGGCTGTGCTCGTCATGCGCAAGGCCGGCGGCAACCCGC
TCGAATACCTCAAGATCACGATGAGCGACGTGCTGGTCACGCGCGTGAAGCCGTCGGGCAGCAAGAACGG
CGAAGAAAAGAGCCTCGAGGAAGTGTCGCTGTCGTTCGCGAAGGTCAAGCAGGAATACGTCGTCCAGAAC
GCCCAGGGCGGCAGCGGCGGCGCCGTGACGGCCAGCTACGACATCAAGGGCAACAAGGAGGCGTAA