SecReT6
Effector Protein ID: 186894000
-
SecReT6 ID277
T6SS typeA3
Gene symbol-
Locus tagYPTS_0671
StrainYersinia pseudotuberculosis PB1/+
Repliconchromosome [GenBank: NC_010634] [Browse all T6SS(s) in this replicon]
Location [Strand]750816..753164 [+]
ProductImpA family type VI secretion-associated protein
Effector typeProtein
Homologous effectorYPK_3558
Descriptiontype VI secretion system Vgr family protein
UniProt IDB2K4A2
KEGG IDypb:YPTS_0671
PDB IDNA
Domain hit(s) vs Pfam Phage_GPD [PF05954], Evalue: 3.40E-64, Aligned region: 25..328
Phage_GPD [PF05954], Evalue: 3.40E-64, Aligned region: 535..598
Phage_GPD [PF05954], Evalue: 3.40E-64, Aligned region: 640..669
Phage_base_V [PF04717], Evalue: 2.30E-23, Aligned region: 365..457
Protein Sequence: 782 a.a.     [Download]
>gi|186894000|ref|YP_001871112.1| ImpA family type VI secretion-associated protein [Yersinia pseudotuberculosis PB1/+]
MQLIEIENEVLSGQDAFPLSFKTQEKVSGNPSYQLVFQVAEADLDLVSLLGEIIKVRIELPDSAGYRTFF
TYVIAGADEGQRQDKFVYSLELSTWTWFLMQNRNCRIFQDLNIIDIIEQVFSKYNFADYRFDIVGNYRLR
EYCVQFAETDFDFVNRLMEDEGVWYYFEHNEDKHTLVMTDQQQFPVLEGHYAELSFLPDSEEMRAIREGI
QRIQRSQRIHSSEIVLRDFDFLNPRNTLQTHIEESRQHLQGVPLEWYDYAAGYTDPQHGESIARLRLEAI
QSNGQLLSGESNATGLVPGRSFALVQHPDNNRNRGFKLISCDYSFVQDGPDSASQGRNVACKFKALNDDV
VYRPQCVTPPPKVPGVQSATVVGARESEVHTDKFARIRVHFHWDRYKTTEDDSSCWIRVVQAWAGKGWGV
LAMPRVGQEVLVNYVDGDLDRPMVTGIVYNGENPPPYRLPDHINYSGFVSRSLRFGQPQHASQLTFDDNR
GNERIMLHAERDLQRTVERNSATAVGQDKYDTVERTATEWINNHISYKDFSFSVTGMSVSATGISVSTTG
TSLSVTGMSTSVTGVSVGFTLIDTSFTGVSTSFTGVGTSFTGASNSLTGVSNSMTGCSSSFTGTSNSMTG
SSHSMTGMSTSITGHSMSQTGSSSSITGDSTSFTGSSVSSTGSSVSTTGVSTSTTGSSTSTTGCSVSTTG
SSTSTTGNSVSMTGNSTSTTGCSISTTGSSIGTVGSSISTTGSSVSTTGSSISTTGLSVSYTGAQYSDVG
VDLKTVGMQSKN
-
Nucleotide Sequence: 2349 bp     [Download]
>gi|186893344|ref|NC_010634.1|:750816-753164 Yersinia pseudotuberculosis PB1/+ chromosome, complete genome
ATGCAATTAATTGAGATAGAGAATGAGGTTTTATCGGGCCAGGATGCTTTTCCTCTCTCCTTCAAGACGC
AGGAAAAAGTGTCAGGGAATCCATCCTACCAACTGGTATTTCAGGTAGCAGAAGCGGACCTCGATCTGGT
CAGTTTGCTGGGGGAAATCATCAAAGTCAGGATTGAGTTACCTGACTCAGCCGGCTACCGGACCTTTTTT
ACCTATGTGATCGCCGGTGCTGATGAAGGGCAACGGCAAGACAAATTTGTTTACAGCCTGGAACTGAGTA
CCTGGACGTGGTTTTTGATGCAAAACCGCAACTGCCGGATATTTCAGGACCTGAATATTATCGATATTAT
CGAACAGGTATTCTCCAAATATAACTTTGCGGATTACCGTTTTGATATCGTCGGTAACTATCGGTTACGC
GAGTACTGCGTACAGTTTGCAGAAACCGATTTCGACTTTGTTAATCGTCTGATGGAAGACGAAGGCGTTT
GGTATTACTTCGAACATAACGAAGATAAGCACACGCTGGTCATGACAGATCAGCAACAATTCCCTGTATT
GGAAGGGCATTATGCAGAACTGAGTTTCCTGCCTGACAGTGAAGAGATGCGCGCCATCCGTGAGGGGATA
CAGCGTATTCAACGCTCACAACGCATCCACTCCAGCGAAATTGTCTTACGTGACTTCGATTTCCTTAATC
CACGCAATACATTACAAACCCATATCGAAGAAAGCCGCCAACACCTGCAAGGCGTACCACTGGAATGGTA
TGACTACGCGGCGGGTTACACCGATCCCCAGCATGGTGAGAGCATCGCCCGTTTACGCCTTGAAGCTATA
CAGAGTAATGGGCAGCTCTTGTCTGGTGAAAGTAATGCCACAGGATTAGTGCCAGGGCGCTCTTTTGCTC
TGGTACAGCACCCTGATAACAACCGTAATCGGGGATTCAAACTGATCAGTTGTGACTACAGTTTTGTCCA
GGATGGGCCGGACAGTGCGAGCCAGGGACGCAATGTCGCCTGTAAGTTTAAGGCATTGAATGATGACGTC
GTTTATCGTCCACAATGTGTCACGCCACCGCCAAAGGTCCCTGGTGTGCAAAGTGCCACAGTGGTCGGTG
CGCGTGAATCAGAAGTGCATACCGATAAGTTCGCCCGTATTCGCGTTCACTTTCACTGGGATCGTTATAA
AACCACCGAAGATGATAGCTCCTGCTGGATCCGCGTTGTACAGGCGTGGGCCGGTAAAGGCTGGGGCGTC
CTGGCGATGCCTCGGGTCGGGCAAGAAGTGCTGGTCAATTACGTTGACGGCGACCTTGATCGCCCGATGG
TGACCGGGATCGTCTACAACGGTGAGAACCCACCGCCTTACCGTTTACCTGACCACATTAACTACTCCGG
TTTTGTCTCACGCTCACTGCGCTTTGGTCAGCCACAACACGCCAGCCAGCTTACCTTCGATGATAATCGG
GGCAATGAGCGGATCATGCTACATGCTGAGCGCGACTTACAAAGAACGGTTGAACGTAACAGTGCGACGG
CCGTCGGTCAGGATAAATACGACACGGTGGAACGGACGGCCACGGAGTGGATCAACAACCATATCTCCTA
CAAAGACTTCAGTTTCTCGGTGACGGGCATGAGTGTCTCCGCGACGGGCATCAGTGTCTCGACAACGGGA
ACGAGCTTATCTGTCACCGGCATGAGCACCAGCGTCACGGGTGTCAGTGTGGGTTTCACCTTGATAGATA
CCTCCTTTACGGGTGTGAGCACATCGTTTACCGGTGTCGGTACCTCCTTCACCGGGGCCAGCAACTCGCT
AACCGGTGTCAGCAACTCGATGACTGGGTGTAGTTCCTCGTTTACCGGTACTAGCAATAGCATGACAGGC
AGTAGCCATAGCATGACCGGCATGAGCACCAGCATCACCGGGCATAGCATGAGTCAGACGGGTTCCAGTA
GCAGCATCACCGGTGACAGTACCTCCTTTACCGGCAGCAGCGTCAGCAGTACGGGCAGCAGCGTCAGTAC
GACCGGTGTCAGTACCAGCACTACGGGGAGTAGCACCTCGACTACCGGTTGTAGCGTCAGTACTACGGGG
AGCAGCACCTCGACTACCGGTAATTCAGTCAGCATGACCGGTAACAGCACCAGTACCACGGGATGCAGTA
TTTCCACGACGGGCAGCAGTATTGGGACGGTAGGAAGCAGTATCAGCACCACGGGCAGTAGCGTCAGTAC
CACCGGTAGCAGTATCAGCACCACGGGATTATCCGTCAGTTATACCGGCGCTCAATATTCCGATGTGGGT
GTCGATCTGAAAACCGTTGGCATGCAAAGCAAAAACTGA