SecReT6
Effector Protein ID: 186896066
SecReT6 ID279
T6SS typeA3
Gene symbol-
Locus tagYPTS_2761
StrainYersinia pseudotuberculosis PB1/+
Repliconchromosome [GenBank: NC_010634] [Browse all T6SS(s) in this replicon]
Location [Strand]3064233..3064802 [-]
ProductHcp1 family type VI secretion system effector
Effector typeProtein
Homologous effectorROD_27741
DescriptionHcp protein
UniProt IDB2K8M3
KEGG IDypb:YPTS_2761
PDB IDNA
Domain hit(s) vs Pfam DUF796 [PF05638], Evalue: 7.30E-43, Aligned region: 34..164
Protein Sequence: 189 a.a.     [Download]
>gi|186896066|ref|YP_001873178.1| Hcp1 family type VI secretion system effector [Yersinia pseudotuberculosis PB1/+]
MCLRIYMGSSYTRCLALSDIYKSAREDIMAQDMFIKIDGIEGESLDANHKNEIQVLAWNWDVAQHSNMHS
GSGGGSGKASVSDFCFAHYIDKASPNLLSYCLLGKHIKNVQFVLRKAGGDPLEYLTIKFTDVIITRVDMA
GSLEDETRPREEIRFSFTKMTQDYVMQNAEGHKSGVISANYDVKANMHS
-
Nucleotide Sequence: 570 bp     [Download]
>gi|186893344|ref|NC_010634.1|:c3064802-3064233 Yersinia pseudotuberculosis PB1/+ chromosome, complete genome
ATGTGCCTCCGTATTTATATGGGGTCTTCCTACACTCGATGTTTGGCATTGAGTGACATTTATAAAAGTG
CTAGAGAGGATATTATGGCGCAAGATATGTTTATCAAAATTGATGGTATTGAAGGTGAGTCTTTGGATGC
CAATCACAAAAACGAAATCCAGGTATTAGCTTGGAACTGGGATGTTGCTCAACACTCGAATATGCACAGC
GGTTCAGGTGGCGGTTCAGGTAAAGCCTCTGTTTCAGATTTTTGCTTCGCACATTATATCGATAAAGCTA
GCCCGAACTTATTGAGCTATTGCTTGCTGGGTAAGCACATTAAAAATGTTCAGTTCGTACTGCGTAAAGC
CGGTGGCGATCCGCTGGAATATCTGACAATTAAATTTACCGATGTCATCATTACTCGTGTTGATATGGCG
GGTTCTTTGGAAGATGAAACGCGTCCACGTGAAGAAATTCGTTTCTCATTCACTAAGATGACTCAGGACT
ATGTTATGCAGAATGCTGAAGGCCATAAATCTGGCGTTATTTCTGCTAACTACGATGTTAAAGCTAACAT
GCACAGCTAA