SecReT6
Effector Protein ID: 187919618
-
SecReT6 ID283
T6SS typeA4b
Gene symbol-
Locus tagBphyt_4915
StrainBurkholderia phytofirmans PsJN
Repliconchromosome II [GenBank: NC_010676] [Browse all T6SS(s) in this replicon]
Location [Strand]1040290..1040793 [+]
Producttype VI secretion system effector, Hcp1 family
Effector typeProtein
Homologous effectorBCAL0343
DescriptionHcp protein
UniProt IDB2TC59
KEGG IDbpy:Bphyt_4915
PDB IDNA
Domain hit(s) vs Pfam DUF796 [PF05638], Evalue: 6.90E-45, Aligned region: 5..140
Protein Sequence: 167 a.a.     [Download]
>gi|187919618|ref|YP_001888649.1| type VI secretion system effector, Hcp1 family [Burkholderia phytofirmans PsJN]
MKDIYLKFGNPAIKGESADKDHAGWIEIDSWSHAITQPRSATASTAGGHTSERCEHADMQFTKDIDVVSP
LIYQHASGGTTFDEVTIDFMRSDGEGNRIKYLEVKLKYVIISSVTPSVVGEGLPTEQFSLKYAAVQWKYT
QQKIGGNQGGNAQGAWSLTKNDKTYAV
-
Nucleotide Sequence: 504 bp     [Download]
>gi|187918714|ref|NC_010676.1|:1040290-1040793 Burkholderia phytofirmans PsJN chromosome 2, complete sequence
ATGAAGGATATCTATTTAAAATTCGGCAATCCGGCGATCAAAGGCGAGTCTGCCGATAAGGATCACGCTG
GTTGGATCGAAATCGATTCGTGGAGTCACGCGATCACGCAACCGCGTTCCGCAACCGCCTCCACGGCAGG
TGGTCACACCTCCGAGCGCTGCGAACATGCCGACATGCAGTTCACGAAAGACATCGACGTGGTCAGCCCG
TTGATCTATCAACACGCGTCGGGCGGCACGACGTTCGACGAAGTCACGATCGACTTCATGCGTTCGGACG
GCGAAGGCAATCGCATCAAGTACCTGGAAGTGAAGCTCAAGTACGTGATCATTTCGAGCGTGACGCCGAG
CGTGGTGGGCGAAGGCCTGCCGACCGAACAGTTCTCGCTGAAGTACGCTGCCGTGCAGTGGAAGTACACG
CAGCAGAAGATCGGCGGCAACCAGGGCGGCAACGCGCAAGGCGCGTGGAGCCTGACGAAGAACGACAAGA
CGTACGCGGTCTGA