SecReT6
Effector Protein ID: 187922939
-
SecReT6 ID284
T6SS typeA3
Gene symbol-
Locus tagBphyt_0938
StrainBurkholderia phytofirmans PsJN
Repliconchromosome I [GenBank: NC_010681] [Browse all T6SS(s) in this replicon]
Location [Strand]1055671..1056153 [-]
Producthypothetical protein
Effector typeProtein
Homologous effectorROD_27741
DescriptionHcp protein
UniProt IDB2T0M4
KEGG IDbpy:Bphyt_0938
PDB IDNA
Domain hit(s) vs Pfam DUF796 [PF05638], Evalue: 9.70E-43, Aligned region: 6..135
Protein Sequence: 160 a.a.     [Download]
>gi|187922939|ref|YP_001894581.1| unnamed protein product [Burkholderia phytofirmans PsJN]
MAQDIFIKINGIDGESQDSAHKNEIEVASWGWQILQQSNMHMGSGGGAGKATVEDLAFEHLVDRASPNLM
KYCLTGKHIDQAVLTVRKAGGNPLEYLKITMNDVIVTQVHPSGSNADNGIREQVRLSFAKVKQEYVVQNA
QGGSGGAVTAGYDIKLNKEA
-
Nucleotide Sequence: 483 bp     [Download]
>gi|187922035|ref|NC_010681.1|:c1056153-1055671 Burkholderia phytofirmans PsJN chromosome 1, complete sequence
ATGGCACAGGACATTTTTATCAAGATCAACGGGATCGACGGCGAATCGCAGGATTCGGCGCACAAGAACG
AAATCGAAGTGGCGAGCTGGGGCTGGCAAATCCTGCAGCAGTCGAACATGCACATGGGTTCGGGCGGCGG
CGCGGGTAAGGCAACTGTCGAAGACCTGGCGTTCGAACACCTGGTCGATCGTGCAAGCCCGAACCTGATG
AAGTATTGCCTGACCGGCAAGCACATCGATCAGGCCGTGCTGACCGTGCGCAAGGCCGGCGGCAATCCGC
TCGAATACCTGAAGATCACGATGAACGACGTCATCGTTACGCAGGTTCATCCGTCGGGCAGCAACGCTGA
CAACGGCATCCGTGAACAGGTGCGCCTGTCGTTCGCGAAGGTCAAGCAGGAATACGTCGTGCAGAACGCC
CAGGGCGGCAGTGGCGGCGCCGTGACGGCAGGCTACGACATCAAGCTCAACAAGGAAGCTTAA