SecReT6
Effector Protein ID: 187931786
-
SecReT6 ID477
T6SS typeB
Gene symbol-
Locus tagFTM_1094
StrainFrancisella tularensis subsp. mediasiatica FSC147
Repliconchromosome [GenBank: NC_010677] [Browse all T6SS(s) in this replicon]
Location [Strand]1172285..1173436 [+]
Producthypothetical protein
Effector typeProtein
Homologous effectorFTL_0118
DescriptionIglI protein
UniProt IDB2SEC3
KEGG IDftm:FTM_1094, ftm:FTM_1704
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 383 a.a.     [Download]
>gi|187931786|ref|YP_001891771.1| hypothetical protein FTM_1094 [Francisella tularensis subsp. mediasiatica FSC147]
MSQIISTLNNIDLVTQDKVNLISNMQIQAKYENAEYKSFIDQLIDNLNTTRSIDIYNLFLSLNSEICLNL
DTVDNISKIISSYLSILNTNFTRISPSESKQKNQLAEKGINKFLVTMDANFAQMQNQDKLLPNNIDSIIE
IVQEVIIFFEKNNLNYNSDFKIQLNKTLRKIKSSLILKDQKNDTYPDKESINQVEATITDQKTIQGSEKW
KTLIEKIEVLKALVESERIFETSIVYNDIQNLLVNFDPKEYFPEIFFPLYKKIAPFIGNIHKNIDYYSSS
IQWSIAQKMYNIDYKSFLDTLEKMPENNFLNSSSDITKNFFYETSSEVEKTPIEEHKIIADTDAIKEEIV
IKQRTNNKKNQNDPVEKISNKIDEDYFEDLFDI
-
Nucleotide Sequence: 1152 bp     [Download]
>gi|187930913|ref|NC_010677.1|:1172285-1173436 Francisella tularensis subsp. mediasiatica FSC147 chromosome, complete genome
ATGAGTCAGATAATATCTACACTAAATAATATTGATTTAGTAACTCAAGATAAAGTAAATCTGATTAGTA
ATATGCAAATACAAGCAAAATATGAAAACGCTGAGTATAAGTCATTTATTGATCAATTAATAGATAATCT
TAATACTACTAGAAGCATAGATATATATAACTTATTTCTATCTTTAAATTCAGAAATATGCCTCAATTTA
GATACGGTTGATAATATCTCTAAAATTATTAGCTCTTATTTATCTATTCTAAATACTAATTTCACAAGAA
TTAGTCCATCAGAATCAAAGCAAAAAAACCAGCTAGCTGAAAAAGGAATAAACAAATTCTTAGTCACTAT
GGATGCAAATTTTGCGCAAATGCAGAATCAAGACAAGTTGTTACCAAATAACATAGATTCTATTATAGAA
ATTGTACAGGAAGTAATAATATTTTTTGAGAAAAATAACTTAAATTATAATTCTGATTTTAAAATCCAAC
TAAATAAGACTCTCAGAAAAATAAAAAGTTCTTTGATTTTAAAAGATCAAAAAAATGATACGTATCCCGA
TAAAGAATCAATAAATCAAGTTGAAGCAACTATCACAGATCAAAAAACCATACAAGGCTCTGAGAAATGG
AAAACTCTTATTGAAAAAATTGAAGTTTTAAAAGCTCTAGTTGAAAGTGAAAGAATATTTGAAACATCTA
TTGTTTATAATGATATACAAAACTTATTAGTTAACTTCGATCCTAAAGAGTATTTTCCAGAAATTTTCTT
TCCATTATACAAGAAGATAGCTCCTTTTATTGGCAATATCCATAAAAACATAGACTACTACTCATCAAGT
ATTCAGTGGAGTATAGCTCAGAAGATGTACAACATAGATTATAAGAGTTTTTTAGATACTCTTGAGAAAA
TGCCCGAAAATAATTTTTTAAATTCTTCTTCTGATATAACTAAAAATTTCTTTTATGAAACATCCTCAGA
GGTGGAAAAAACTCCTATCGAAGAACATAAAATAATTGCAGATACAGATGCTATCAAAGAAGAAATAGTA
ATAAAACAGCGAACCAATAATAAAAAAAACCAGAATGACCCCGTAGAAAAAATTTCAAATAAAATAGATG
AAGACTATTTTGAAGATCTTTTTGACATATAA