SecReT6
Effector Protein ID: 188532767
-
SecReT6 ID285
T6SS typeA3
Gene symbol-
Locus tagETA_06200
StrainErwinia tasmaniensis Et1/99
Repliconchromosome [GenBank: NC_010694] [Browse all T6SS(s) in this replicon]
Location [Strand]683237..683719 [+]
Producthypothetical protein
Effector typeProtein
Homologous effectorSMA2263
DescriptionHcp protein
UniProt IDB2VH82
KEGG IDeta:ETA_06200
PDB IDNA
Domain hit(s) vs Pfam DUF796 [PF05638], Evalue: 2.50E-39, Aligned region: 6..136
Protein Sequence: 160 a.a.     [Download]
>gi|188532767|ref|YP_001906564.1| hypothetical protein ETA_06200 [Erwinia tasmaniensis Et1/99]
MAIDMYLKVDGITGESKDSNHTGWIDVTSFSWGATQPGNMSVGGGGGAGKVNFNDLHINAKIDKAVTALL
KNCASGKHVGKVEVSVCKAGGTQIEYTRITLEDVLVTNVQFVGSDGDDTLGVTYAFQAAKVKQQYWEQST
SGGKGAESSAGWNIKENKEA
-
Nucleotide Sequence: 483 bp     [Download]
>gi|188532165|ref|NC_010694.1|:683237-683719 Erwinia tasmaniensis Et1/99 chromosome, complete genome
ATGGCTATTGATATGTATTTGAAAGTTGACGGTATAACCGGTGAATCTAAAGATTCTAACCACACCGGCT
GGATCGATGTGACTTCTTTCTCCTGGGGCGCTACCCAGCCGGGCAACATGTCCGTAGGCGGCGGCGGCGG
TGCCGGTAAAGTGAACTTTAACGATCTGCACATCAATGCAAAAATCGATAAGGCGGTTACCGCGCTGCTG
AAAAACTGCGCCAGCGGTAAGCACGTAGGCAAAGTCGAGGTCTCCGTATGTAAAGCGGGCGGCACTCAGA
TTGAGTACACCCGTATTACTCTGGAAGACGTGCTGGTCACCAACGTGCAGTTCGTCGGTTCCGACGGTGA
CGATACTCTGGGCGTAACCTACGCATTCCAGGCTGCCAAAGTGAAACAGCAGTACTGGGAGCAGAGCACC
TCCGGCGGTAAAGGCGCAGAAAGCAGCGCTGGCTGGAATATTAAAGAGAATAAAGAAGCTTAA