SecReT6
Effector Protein ID: 188532768
-
SecReT6 ID285
T6SS typeA3
Gene symbol-
Locus tagETA_06210
StrainErwinia tasmaniensis Et1/99
Repliconchromosome [GenBank: NC_010694] [Browse all T6SS(s) in this replicon]
Location [Strand]683799..684278 [+]
Producthypothetical protein
Effector typeProtein
Homologous effectorSMA2264
DescriptionSsp2
UniProt IDB2VH84
KEGG IDeta:ETA_06210
PDB IDNA
Domain hit(s) vs Pfam DUF4285 [PF14113], Evalue: 3.50E-29, Aligned region: 46..156
Protein Sequence: 159 a.a.     [Download]
>gi|188532768|ref|YP_001906565.1| hypothetical protein ETA_06210 [Erwinia tasmaniensis Et1/99]
MVIRPAFLQAWQRFSEINIDVSSVGKKIGGNVGANITLGEQDPAQGFTNACAIRMSYTLNYSGAKVERGV
WKTVSGDDKNWYIYRVKDLLTYMHKKYGKPDKIVKNPKPGDFQNLKGILVFAVNGWSDASGHATLWNGSV
CSDHCYFPISNEGSIWLLK
-
Nucleotide Sequence: 480 bp     [Download]
>gi|188532165|ref|NC_010694.1|:683799-684278 Erwinia tasmaniensis Et1/99 chromosome, complete genome
ATGGTAATAAGACCCGCTTTTTTACAGGCATGGCAGCGCTTCAGTGAGATAAATATCGATGTTTCATCTG
TTGGAAAAAAGATAGGTGGAAATGTCGGTGCAAATATCACTCTAGGCGAACAGGACCCCGCACAGGGATT
TACCAATGCCTGCGCGATAAGAATGAGTTACACGTTAAACTACTCTGGGGCTAAGGTCGAAAGGGGCGTC
TGGAAAACGGTTTCAGGAGATGATAAAAATTGGTACATATACCGGGTGAAAGACCTGTTGACGTATATGC
ATAAAAAATACGGTAAACCTGACAAGATAGTAAAAAATCCAAAGCCCGGTGATTTTCAAAATCTGAAAGG
GATATTGGTTTTTGCAGTCAATGGCTGGAGTGATGCAAGCGGGCATGCAACGTTGTGGAATGGGTCGGTT
TGTTCCGATCACTGTTATTTCCCGATTTCGAATGAGGGGTCAATATGGTTATTAAAATAG