SecReT6
Effector Protein ID: 190892083
rbsBch2
SecReT6 ID290
T6SS typeA3
Gene symbolrbsBch2
Locus tagRHECIAT_CH0002495
StrainRhizobium etli CIAT 652
Repliconplasmid pB [GenBank: NC_010994] [Browse all T6SS(s) in this replicon]
Location [Strand]2508726..2509655 [+]
Productribose ABC transporter substrate-binding protein
Effector typeProtein
Homologous effectorRbsB
Description
UniProt IDB3PQ18
KEGG IDrec:RHECIAT_CH0002495
PDB IDNA
Domain hit(s) vs Pfam Peripla_BP_4 [PF13407], Evalue: 5.10E-54, Aligned region: 30..284
Peripla_BP_1 [PF00532], Evalue: 7.40E-17, Aligned region: 28..280
Peripla_BP_6 [PF13458], Evalue: 3.00E-12, Aligned region: 54..260
Peripla_BP_3 [PF13377], Evalue: 3.60E-07, Aligned region: 34..88
Peripla_BP_3 [PF13377], Evalue: 3.60E-07, Aligned region: 152..296
DUF917 [PF06032], Evalue: 0.0014, Aligned region: 70..115
DUF917 [PF06032], Evalue: 0.0014, Aligned region: 180..201
DUF3798 [PF12683], Evalue: 0.0043, Aligned region: 42..65
DUF3798 [PF12683], Evalue: 0.0043, Aligned region: 165..279
Protein Sequence: 309 a.a.     [Download]
>gi|190892083|ref|YP_001978625.1| ribose ABC transporter substrate-binding protein [Rhizobium etli CIAT 652]
MKIARTMLASAALLGLMLGPVHAAELKKLGLAVANLQANFFNQIKQSVEAEAKKRGIEVITVDAKGDGPT
QVNQIQDLLTQKIDALIYIPAGAAAATVPVKLAKNAGIPVVNVDRNAEGAPGDTFLATDSVASAKAVCDY
ILKEAGGKGKMVIIHGQKGTTPEVDRSKGCGESLKAYPDVKVVAEQYSNIWSQDEGFQIMQNMLQANPDV
SIVFAQADGLALGAAQAIKVANPSQKIVVGGFDGDTAALEALSKGVFNVTATQQTQKMGRDAVENAAKLV
AGEKVPPVQLLDATLTTKENVAGFIANHP
-
Nucleotide Sequence: 930 bp     [Download]
>gi|190889639|ref|NC_010994.1|:2508726-2509655 Rhizobium etli CIAT 652 chromosome, complete genome
ATGAAAATTGCGCGCACCATGCTCGCGTCCGCTGCACTGCTCGGCCTCATGCTCGGTCCCGTACACGCCG
CGGAACTGAAGAAGCTTGGCCTGGCCGTTGCGAACCTTCAGGCAAACTTCTTCAACCAGATCAAGCAATC
GGTCGAGGCCGAAGCCAAGAAGCGCGGCATCGAAGTCATCACCGTCGACGCAAAGGGTGACGGGCCGACG
CAGGTCAACCAGATCCAGGATCTTCTGACCCAGAAAATCGACGCGCTGATCTACATTCCGGCAGGTGCGG
CAGCGGCGACCGTTCCAGTCAAGCTCGCGAAGAACGCCGGCATTCCGGTCGTCAACGTCGACCGCAACGC
CGAAGGCGCGCCGGGCGATACATTCCTCGCAACCGATTCCGTCGCGTCTGCCAAGGCGGTGTGCGACTAC
ATCCTGAAGGAAGCCGGCGGCAAGGGGAAGATGGTCATCATCCATGGCCAGAAGGGCACGACGCCGGAAG
TCGATCGCTCGAAGGGCTGCGGCGAATCCCTCAAGGCCTATCCGGATGTGAAGGTTGTCGCCGAACAATA
TTCCAACATCTGGAGCCAGGACGAAGGCTTCCAGATCATGCAGAATATGCTGCAGGCAAATCCCGATGTC
TCGATCGTCTTCGCACAGGCCGATGGCCTCGCACTTGGCGCCGCTCAGGCAATCAAGGTCGCAAATCCCT
CGCAGAAGATCGTGGTCGGCGGCTTCGATGGCGACACTGCGGCTCTCGAAGCGCTCAGCAAGGGCGTCTT
CAACGTGACGGCAACCCAGCAGACGCAGAAAATGGGCCGCGATGCGGTCGAAAACGCCGCCAAGCTTGTC
GCCGGTGAAAAGGTACCGCCGGTACAGCTCTTGGATGCCACGCTGACAACCAAGGAAAACGTCGCAGGCT
TCATCGCCAACCACCCGTAA