SecReT6
Effector Protein ID: 194443822
-
SecReT6 ID293
T6SS typeA3
Gene symbol-
Locus tagSNSL254_A0305
StrainSalmonella enterica subsp. enterica serovar Newport str. SL254
Repliconchromosome [GenBank: NC_011080] [Browse all T6SS(s) in this replicon]
Location [Strand]320859..321344 [+]
Producthemolysin-coregulated protein
Effector typeProtein
Homologous effectorSciK
DescriptionHcp protein
UniProt IDB4SV55
KEGG IDsee:SNSL254_A0305
PDB IDNA
Domain hit(s) vs Pfam DUF796 [PF05638], Evalue: 4.10E-42, Aligned region: 6..136
Protein Sequence: 161 a.a.     [Download]
>gi|194443822|ref|YP_002039513.1| unnamed protein product [Salmonella enterica subsp. enterica serovar Newport str. SL254]
MSYDIFLKIDGIDGESMDDKHKNEIEVLSWRWNIHQESTMHAGSGLGSGKVSVTNLSFEHYIDRASPNLF
KYCSSGKHIPQAILVMRKAGGNPLEYLKYTFTDLIIAMVSPSGSQGGEIASRESIELSFSTVKQEYVVQN
QQGGSGGTITAGYDFKANKEI
-
Nucleotide Sequence: 486 bp     [Download]
>gi|194442203|ref|NC_011080.1|:320859-321344 Salmonella enterica subsp. enterica serovar Newport str. SL254 chromosome, complete genome
ATGTCTTATGACATTTTTCTGAAAATTGACGGCATTGACGGCGAGTCAATGGATGACAAACACAAAAATG
AAATTGAAGTACTGAGCTGGCGCTGGAATATTCATCAGGAATCCACCATGCACGCCGGTAGCGGTCTCGG
TTCCGGTAAGGTCTCCGTCACTAATCTTTCATTTGAACATTACATCGATCGCGCCAGCCCGAACCTGTTC
AAATACTGCTCTTCCGGTAAGCACATTCCGCAGGCCATTCTGGTTATGCGTAAGGCTGGCGGCAATCCGC
TGGAGTACCTCAAGTACACTTTCACAGATCTGATTATTGCAATGGTATCGCCTAGCGGAAGCCAGGGAGG
GGAAATTGCGTCTCGCGAATCAATTGAACTCTCCTTCAGCACCGTGAAGCAGGAATACGTGGTGCAGAAC
CAGCAGGGCGGCAGCGGCGGCACCATCACCGCAGGCTACGACTTCAAGGCCAACAAAGAAATTTAA