SecReT6
Effector Protein ID: 194449410
-
SecReT6 ID294
T6SS typeA3
Gene symbol-
Locus tagSeHA_C0314
StrainSalmonella enterica subsp. enterica serovar Heidelberg str. SL476
Repliconchromosome [GenBank: NC_011083] [Browse all T6SS(s) in this replicon]
Location [Strand]324862..325347 [+]
Producthemolysin-coregulated protein
Effector typeProtein
Homologous effectorSciK
DescriptionHcp protein
UniProt IDB4T7K8
KEGG IDseh:SeHA_C0314
PDB IDNA
Domain hit(s) vs Pfam DUF796 [PF05638], Evalue: 4.10E-41, Aligned region: 6..136
Protein Sequence: 161 a.a.     [Download]
>gi|194449410|ref|YP_002044259.1| hemolysin-coregulated protein [Salmonella enterica subsp. enterica serovar Heidelberg str. SL476]
MAYDIFLKIDGIDGESMDDKHKNEIEVLSWRWNIHQESTMHAGSGLGSGKVSVTNLDFDHYIDRASPNLF
KYCASGKHIPQAILVMRKAGGNPLEYLKYTFTDLIVAVVSPSGSHDGEIASRETVELSFSTVKQEYVVQN
QQGGSGGTITAGYDFKANKEI
-
Nucleotide Sequence: 486 bp     [Download]
>gi|194447306|ref|NC_011083.1|:324862-325347 Salmonella enterica subsp. enterica serovar Heidelberg str. SL476 chromosome, complete genome
ATGGCTTATGACATTTTTCTGAAAATTGACGGCATCGACGGTGAGTCGATGGATGACAAACACAAAAATG
AAATTGAAGTACTGAGCTGGCGCTGGAATATCCATCAGGAATCCACCATGCACGCCGGTAGCGGCCTCGG
CTCCGGTAAGGTCTCCGTCACCAACCTGGATTTTGATCACTATATCGACCGCGCCAGCCCGAACCTGTTC
AAATACTGCGCCTCCGGCAAGCACATTCCGCAGGCCATTCTGGTTATGCGTAAGGCTGGCGGCAATCCGC
TGGAGTACCTCAAGTATACCTTCACCGACCTGATTGTCGCCGTGGTTTCCCCGAGCGGCAGCCACGATGG
TGAAATCGCCTCCCGTGAAACGGTAGAGCTTTCTTTCAGCACTGTGAAACAGGAATACGTGGTGCAGAAC
CAGCAGGGCGGCAGCGGCGGCACTATCACCGCAGGTTACGATTTCAAGGCGAACAAAGAAATTTAA