SecReT6
Effector Protein ID: 194734020
-
SecReT6 ID295
T6SS typeA3
Gene symbol-
Locus tagSeSA_A0311
StrainSalmonella enterica subsp. enterica serovar Schwarzengrund str. CVM19633
Repliconchromosome [GenBank: NC_011094] [Browse all T6SS(s) in this replicon]
Location [Strand]321030..321515 [+]
Producthemolysin-coregulated protein
Effector typeProtein
Homologous effectorSciK
DescriptionHcp protein
UniProt IDB4TYI7
KEGG IDsew:SeSA_A0311
PDB IDNA
Domain hit(s) vs Pfam DUF796 [PF05638], Evalue: 4.30E-42, Aligned region: 6..136
Protein Sequence: 161 a.a.     [Download]
>gi|194734020|ref|YP_002113297.1| hemolysin-coregulated protein [Salmonella enterica subsp. enterica serovar Schwarzengrund str. CVM19633]
MSYDIFLKIDGIDGESMDDKHKNEIEVLSWRWNIHQESTMHAGSGLGSGKVSVTHLSFEHYIDRASPNLF
KYCSSGKHIPQAILVMRKAGGNPLEYLKYTFTDLIIAMVSPSGSQGGEIASRESIELSFSTVKQEYVVQN
QQGGSGGTITAGYDFKANKEI
-
Nucleotide Sequence: 486 bp     [Download]
>gi|194733902|ref|NC_011094.1|:321030-321515 Salmonella enterica subsp. enterica serovar Schwarzengrund str. CVM19633 chromosome, complete genome
ATGTCTTATGATATTTTTCTGAAAATTGACGGCATCGACGGTGAGTCGATGGATGACAAACACAAAAATG
AAATTGAAGTACTGAGCTGGCGCTGGAATATCCATCAGGAATCCACCATGCACGCCGGTAGCGGTCTCGG
TTCCGGTAAAGTATCTGTTACTCATCTTTCATTTGAACATTACATCGATCGCGCCAGCCCGAACCTGTTC
AAATACTGCTCTTCTGGCAAGCACATTCCGCAGGCCATTCTGGTTATGCGTAAGGCTGGCGGCAATCCGC
TGGAGTACCTCAAGTACACCTTCACAGATCTGATTATTGCAATGGTATCGCCCAGCGGAAGCCAGGGAGG
GGAAATTGCGTCTCGCGAATCAATTGAACTCTCTTTCAGCACCGTGAAGCAGGAATACGTGGTGCAGAAC
CAGCAGGGCGGCAGCGGCGGCACCATCACCGCAGGCTACGACTTCAAGGCCAACAAAGAAATTTAA