SecReT6
Effector Protein ID: 194735460
-
SecReT6 ID295
T6SS typeA3
Gene symbol-
Locus tagSeSA_A2604
StrainSalmonella enterica subsp. enterica serovar Schwarzengrund str. CVM19633
Repliconchromosome [GenBank: NC_011094] [Browse all T6SS(s) in this replicon]
Location [Strand]2489772..2489990 [+]
Producthypothetical protein
Effector typeProtein
Homologous effectorSTY2606
DescriptionTae3_TY
UniProt IDB4TQB0
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 72 a.a.     [Download]
>gi|194735460|ref|YP_002115445.1| hypothetical protein SeSA_A2604 [Salmonella enterica subsp. enterica serovar Schwarzengrund str. CVM19633]
MLRSAGFTAIGTYEMPREGDVIIIQPYAGGNPSGHMAIYDGAEWYSDFKQRDMWAGPGYRAARPSYTIYR
KN
-
Nucleotide Sequence: 219 bp     [Download]
>gi|194733902|ref|NC_011094.1|:2489772-2489990 Salmonella enterica subsp. enterica serovar Schwarzengrund str. CVM19633 chromosome, complete genome
ATGTTAAGAAGCGCCGGATTCACCGCTATTGGTACCTATGAAATGCCGCGCGAGGGTGACGTCATTATTA
TTCAACCTTACGCTGGCGGAAACCCGAGCGGTCACATGGCGATATACGATGGCGCAGAGTGGTATTCAGA
TTTTAAACAACGCGATATGTGGGCCGGCCCGGGCTACCGGGCAGCCAGGCCCTCATATACCATCTACAGG
AAGAATTAA