SecReT6
Effector Protein ID: 197284644
-
SecReT6 ID272
T6SS typeA1
Gene symbol-
Locus tagPMI0750
StrainProteus mirabilis HI4320
Repliconchromosome [GenBank: NC_010554] [Browse all T6SS(s) in this replicon]
Location [Strand]831710..832228 [+]
Producthypothetical protein
Effector typeProtein
Homologous effectorECA2866
DescriptionHcp protein
UniProt IDB4EVA3
KEGG IDpmr:PMI0750
PDB IDNA
Domain hit(s) vs Pfam DUF796 [PF05638], Evalue: 1.10E-37, Aligned region: 6..156
Protein Sequence: 172 a.a.     [Download]
>gi|197284644|ref|YP_002150516.1| hypothetical protein PMI0750 [Proteus mirabilis HI4320]
MPTPCYISIEGKNQGNITAGAFTADSVGNIYVQGHEDQMLVQEFSHVVTVPTDPQSGQPSGQRAHKPFRF
TVALNKAVPLLYNALASGEMLPKVELKWYRTSVEGKQEHFFTTTLTDATIVNIDCQMPHCQDPAKADFTQ
LIEVSLSYRKIDWEHTVAGTSGADDWRAPLEA
-
Nucleotide Sequence: 519 bp     [Download]
>gi|197283915|ref|NC_010554.1|:831710-832228 Proteus mirabilis HI4320 chromosome, complete genome
ATGCCAACTCCTTGCTATATTTCCATTGAAGGAAAAAATCAGGGCAACATCACTGCAGGCGCGTTTACTG
CAGATTCTGTCGGCAACATTTATGTACAAGGTCATGAAGACCAAATGTTGGTACAAGAATTTTCTCACGT
AGTGACGGTTCCGACTGATCCGCAATCAGGCCAACCTTCTGGCCAACGTGCGCATAAACCGTTTCGTTTT
ACCGTGGCATTAAACAAAGCCGTTCCTCTGCTGTATAACGCATTGGCTTCCGGCGAAATGCTGCCAAAAG
TTGAGTTAAAATGGTATCGCACGTCTGTTGAAGGTAAACAAGAGCACTTCTTTACCACCACACTGACTGA
CGCGACGATCGTGAACATCGATTGCCAAATGCCTCATTGCCAAGATCCGGCTAAAGCCGACTTCACGCAA
CTTATCGAAGTCTCCCTCTCTTACCGCAAAATTGACTGGGAGCACACTGTTGCTGGAACGTCTGGTGCGG
ATGACTGGCGTGCGCCTCTCGAAGCGTAA