SecReT6
Effector Protein ID: 197284988
hcp
SecReT6 ID272
T6SS typeA1
Gene symbolhcp
Locus tagPMI1117
StrainProteus mirabilis HI4320
Repliconchromosome [GenBank: NC_010554] [Browse all T6SS(s) in this replicon]
Location [Strand]1185979..1186497 [+]
Producthypothetical protein
Effector typeProtein
Homologous effectorECA2866
DescriptionHcp protein
UniProt IDB4ETP9
KEGG IDpmr:PMI1117
PDB IDNA
Domain hit(s) vs Pfam DUF796 [PF05638], Evalue: 1.10E-37, Aligned region: 6..156
Protein Sequence: 172 a.a.     [Download]
>gi|197284988|ref|YP_002150860.1| hypothetical protein PMI1117 [Proteus mirabilis HI4320]
MPTPCYISIEGKTQGNITAGAFTADSVGNIYVQGHEDQMLVQEFSHVVTVPTDPQSGQPSGQRAHKPFRF
TVALNKAVPLLYNALASGEMLPKVELKWYRTSVEGKQEHFFTTTLTDATIVNIDCQMPHCQDPAKADFTQ
LIEVSLSYRKIDWEHTVAGTSGADDWRAPLEA
-
Nucleotide Sequence: 519 bp     [Download]
>gi|197283915|ref|NC_010554.1|:1185979-1186497 Proteus mirabilis HI4320 chromosome, complete genome
ATGCCAACTCCTTGCTATATTTCCATTGAAGGAAAAACTCAGGGCAACATCACTGCAGGCGCGTTTACTG
CAGATTCTGTCGGCAACATTTATGTACAAGGTCATGAAGACCAAATGTTGGTACAAGAATTTTCTCACGT
GGTGACGGTTCCGACTGATCCGCAATCAGGCCAACCTTCTGGCCAACGTGCGCATAAACCGTTTCGTTTT
ACCGTGGCATTAAATAAAGCCGTTCCTCTGCTGTATAACGCATTGGCTTCCGGCGAAATGCTGCCAAAAG
TTGAGTTAAAATGGTATCGCACGTCTGTTGAAGGTAAACAAGAGCACTTCTTTACCACCACACTGACTGA
CGCGACGATCGTGAACATCGATTGCCAAATGCCTCATTGTCAAGATCCGGCTAAAGCCGACTTCACGCAA
CTTATCGAAGTCTCCCTCTCTTACCGCAAAATTGACTGGGAGCACACTGTTGCTGGAACGTCTGGTGCGG
ATGACTGGCGTGCGCCTCTCGAAGCGTAA