SecReT6
Effector Protein ID: 197284989
-
SecReT6 ID272
T6SS typeA1
Gene symbol-
Locus tagPMI1118
StrainProteus mirabilis HI4320
Repliconchromosome [GenBank: NC_010554] [Browse all T6SS(s) in this replicon]
Location [Strand]1186581..1188683 [+]
ProductRhs family protein
Effector typeProtein
Homologous effectoridrB
DescriptionVgrG
UniProt IDB4ETQ0
KEGG IDpmr:PMI1118
PDB IDNA
Domain hit(s) vs Pfam Phage_GPD [PF05954], Evalue: 6.70E-51, Aligned region: 130..421
Phage_base_V [PF04717], Evalue: 1.50E-19, Aligned region: 463..551
Gp5_C [PF06715], Evalue: 0.0043, Aligned region: 120..131
Gp5_C [PF06715], Evalue: 0.0043, Aligned region: 593..606
Gp5_C [PF06715], Evalue: 0.0043, Aligned region: 608..631
Gp5_C [PF06715], Evalue: 0.0043, Aligned region: 635..655
Protein Sequence: 700 a.a.     [Download]
>gi|197284989|ref|YP_002150861.1| Rhs family protein [Proteus mirabilis HI4320]
MLSKDPKSTPIDPASVLKDEAINQVKNRVQSKVNETLSTPTQKVAGMASAAASLTQSASASANRVTAHPL
IHGGGFTGGQTFAENQALQAAHGALLDALGMDSLESGLVFTCTIGGLPDDTFQVTEFNLTEGLSSLFSLS
ISAVSALPFIDFQRHLGLASSLTVKRDGVLIRKVNGILAGAVQGNTDGVKTWYHFDIRPEMWVMTLNQDS
RIFQHQSVPTILKTLLDEAHVKADCQFYREDLHPERLYTTQKRESAFDFWCRLAFEEGINFWFEEEQLFY
SDEHMGMTAGIHLTYNPQADTDISDSTAMTWQYGEYLCVDETIHKDNNFVRPSYPLSHENKIEQGGQHSV
FESYGRFQLDDEGRPLTQVRFEQLRNGSKVGQATTNCFALMPGKIFTLSQHPHLPMNDRWQVISVSHHGV
QPLADNSGGEGTQLSNSVSFIPGTQEWRPPYRYKPTADGDEVATVVGPPGEEIYVNEYGAVKVHFHWDRR
GSADHSASCWVRVAMGWSGNGYGFSAVPRIGTQVLVSYLNGDIDRPIITGCTYDGRNAPPIKFPENKTQT
TFRSQTHKGEGFNELRFEDAGGKQEVFLHAQKDMNTRVLHDRTTHVLHDHVEVIENNQQMQVKGARTETI
DKDNSETVGQHKKITVGKTLSINVGEVIELRCGASVLRMDNGGHVTINGQEFKFEATGPVKITGKDIDLN
-
Nucleotide Sequence: 2103 bp     [Download]
>gi|197283915|ref|NC_010554.1|:1186581-1188683 Proteus mirabilis HI4320 chromosome, complete genome
ATGCTTAGCAAAGATCCGAAATCAACGCCCATTGACCCGGCATCCGTTTTAAAAGATGAAGCCATCAATC
AAGTGAAAAATAGGGTGCAATCCAAAGTGAACGAAACGCTATCGACACCCACGCAAAAGGTGGCCGGGAT
GGCCTCAGCAGCGGCCTCGCTCACTCAATCAGCCAGCGCATCGGCCAATCGCGTGACGGCTCATCCCCTG
ATCCACGGTGGCGGTTTTACCGGTGGACAAACGTTCGCTGAAAACCAAGCACTCCAAGCGGCCCATGGGG
CGTTACTTGATGCATTAGGCATGGACAGCCTCGAAAGTGGTTTGGTGTTCACTTGCACCATTGGTGGATT
GCCTGACGACACCTTTCAAGTCACCGAATTTAATCTTACCGAAGGATTATCCTCGCTATTTTCACTGTCC
ATCAGTGCGGTCAGTGCCTTACCCTTTATCGATTTCCAGCGCCATCTTGGCTTAGCCTCATCATTAACGG
TCAAACGCGATGGGGTGTTGATCCGCAAAGTCAACGGTATCTTAGCTGGGGCAGTACAAGGCAATACCGA
CGGAGTGAAAACGTGGTATCACTTCGATATTCGCCCTGAAATGTGGGTGATGACCCTCAATCAAGACAGC
CGTATTTTTCAACATCAATCGGTGCCGACCATCTTAAAAACCTTATTGGATGAGGCCCATGTTAAAGCGG
ATTGCCAATTCTACCGTGAAGATCTACACCCTGAACGTCTCTACACCACCCAAAAACGCGAATCCGCATT
TGATTTTTGGTGTCGACTGGCGTTTGAAGAGGGCATTAACTTCTGGTTTGAAGAAGAACAACTGTTTTAC
AGCGATGAACATATGGGGATGACGGCGGGTATTCACCTCACCTATAACCCGCAGGCCGACACCGATATCA
GCGATAGCACTGCCATGACTTGGCAATATGGCGAATATTTGTGTGTGGATGAAACTATCCATAAAGACAA
CAACTTTGTTCGTCCTTCTTATCCGTTGTCTCATGAAAACAAAATTGAGCAGGGAGGACAGCACAGTGTG
TTTGAAAGTTATGGTCGTTTTCAATTAGACGATGAAGGTCGCCCCCTAACACAGGTGCGCTTTGAGCAAT
TACGTAACGGCAGCAAAGTGGGGCAAGCGACAACAAACTGTTTTGCGCTGATGCCCGGCAAAATCTTCAC
CTTATCTCAGCATCCCCATCTGCCGATGAATGATCGCTGGCAAGTGATCAGCGTCAGCCATCATGGTGTA
CAGCCATTGGCGGACAATAGCGGGGGCGAAGGCACACAACTGTCGAATAGTGTCTCCTTTATTCCGGGCA
CGCAAGAGTGGCGTCCCCCTTATCGTTATAAACCGACGGCCGACGGCGATGAAGTGGCGACGGTGGTGGG
ACCGCCGGGGGAAGAAATCTACGTCAATGAATATGGCGCCGTGAAAGTGCATTTTCATTGGGATCGTCGG
GGAAGTGCCGATCACAGTGCTTCATGCTGGGTGCGGGTTGCCATGGGTTGGAGTGGAAATGGCTATGGTT
TTTCTGCGGTACCGCGCATCGGCACACAAGTGTTGGTCAGTTACCTGAATGGGGATATTGACAGACCGAT
AATTACCGGTTGTACCTATGATGGTCGTAACGCACCACCGATTAAGTTCCCAGAGAATAAGACACAAACT
ACTTTCCGTAGCCAAACCCACAAAGGGGAAGGTTTTAATGAATTGCGTTTTGAAGATGCGGGCGGTAAGC
AAGAGGTGTTTCTTCATGCGCAGAAGGATATGAATACCCGTGTTCTTCATGATCGCACTACCCATGTTTT
ACACGATCATGTTGAAGTGATCGAAAACAATCAACAGATGCAGGTGAAAGGCGCTCGCACAGAAACGATA
GATAAAGATAACAGCGAAACGGTAGGCCAACATAAAAAAATTACTGTAGGCAAAACATTATCTATCAATG
TCGGTGAAGTCATTGAATTACGTTGTGGAGCAAGTGTGCTACGAATGGATAATGGTGGGCATGTCACGAT
TAATGGTCAGGAATTTAAGTTTGAAGCTACAGGTCCTGTGAAAATTACGGGTAAAGATATCGATTTAAAC
TAA