SecReT6
Effector Protein ID: 197286822
-
SecReT6 ID272
T6SS typeA1
Gene symbol-
Locus tagPMI2993
StrainProteus mirabilis HI4320
Repliconchromosome [GenBank: NC_010554] [Browse all T6SS(s) in this replicon]
Location [Strand]3282912..3286013 [+]
Producthypothetical protein
Effector typeProtein
Homologous effectoridsD
Description
UniProt IDB4F004
KEGG IDpmr:PMI2993
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 1033 a.a.     [Download]
>gi|197286822|ref|YP_002152694.1| hypothetical protein PMI2993 [Proteus mirabilis HI4320]
MTGEVNEKYLTPQERKARQMVKAVNEASPRNLPADAVVCPCENEHRPVYPVRYAYTNFYCDLHFSTIEQA
PNKTLEASIPPSINQLLNAKDVTASKGFSARLLRQGWVYVFEEGNYPTRSNSSNKSYQEQNVDATKGRLL
VFQHQVTTSDGNENFIPYIFKQLKNGGVTLKKNGNSNPYLAIPKDVKEATILFSESKLSDYTLKKIISSS
KFRSKLMQKINFIDYNNNDYCIELNKDNLNRLVEDYKEEVDKFKLFVKEFTHSNIPSSFFSDTTKIPDLP
QDATVLINQINSVLDYNEKATLLILKDPVGYQKDVLSYYNIVTKLHLLYQNYYSHPDKIGQFITSIQEAS
HHIKDTDEKEKMQTILKESINQNALDNEWKNIHKTFIFFEKHQRIVLSLYESFMNNPAIINENGGLKHYF
DYAFSYHERITKEDVFSIDFFKDLNQAFDLYFDLISPLMNSTEGQRTLDKLYSINDEENNSLWVGVTKKV
ISLVANSKIMDALLNAQEYAENIENFVNKLAFICSDSIGFAFTKTSKMLSHYDIKNRLINTKGIDYLAQK
ILPMILAFCNTKISLTEFVKLSGNELNQWVEQLRKLTEQIVPNLQHPKLNKLFSWKQKIINLGEETAVLI
PKIEITDITKNKIYIYGKDALQVSTKLFLNGFSMITGSIQAYTLQGMSLYERNDPLKLSPYNLYTAQIIA
NLFVASYSILKVSQEATKLSQTVSSTTLKFFLDKIKLPMLTTEVGTKRMAALGKIAGAVGVALATRDALE
AFHIGNNKQGLSNVAIAIGSFMLIFVTGGWALFAGLLILGGFFSSQLTSWSHLETLLRHSFWGNEESSNF
WDNNRPTPIGEQLKQYIKEFEFYEQKGLIELQEFYNLFYTAKMTQEKIPNGKLRLSFEFTNFTPGISEVY
FHFVTEVGYHSGLAEEIKTPSSAYVLNKRKDLLEISEQLKMASEKGDWNPETGILKFSLEVQSQLVNTYS
AFGAHPNSRIGIEDLYWYYQVNPEVTTPMRYINWGGDTQENNRLLGFINSENI
-
Nucleotide Sequence: 3102 bp     [Download]
>gi|197283915|ref|NC_010554.1|:3282912-3286013 Proteus mirabilis HI4320 chromosome, complete genome
ATGACTGGAGAAGTGAATGAGAAATATTTAACACCGCAAGAGCGCAAAGCGCGTCAGATGGTGAAGGCGG
TAAACGAAGCGAGCCCACGAAACTTACCGGCCGACGCGGTGGTATGCCCATGTGAAAATGAACATCGCCC
TGTTTATCCGGTGCGTTATGCATATACCAACTTTTATTGTGATTTACATTTTTCTACAATTGAACAAGCA
CCAAATAAAACGTTAGAAGCGAGTATTCCTCCTTCTATTAATCAATTATTGAATGCGAAAGATGTTACTG
CTAGTAAAGGATTTTCTGCAAGATTATTAAGACAAGGTTGGGTTTATGTTTTTGAAGAAGGCAATTACCC
TACTAGAAGTAATTCTAGTAATAAAAGTTATCAAGAACAAAATGTTGATGCGACAAAAGGACGCCTATTA
GTTTTTCAACATCAAGTTACAACCAGTGATGGCAATGAAAATTTCATTCCATATATATTTAAGCAATTAA
AAAATGGGGGTGTCACTTTAAAGAAAAACGGAAATAGTAATCCTTATTTAGCTATACCGAAAGATGTGAA
GGAAGCGACTATCTTATTCAGCGAAAGTAAATTATCTGATTACACACTTAAAAAAATCATTTCATCTTCT
AAGTTTAGATCGAAATTAATGCAAAAAATCAATTTTATTGATTACAACAATAACGATTATTGTATTGAGC
TAAATAAAGATAATTTAAATCGACTTGTTGAGGATTATAAAGAAGAAGTTGATAAATTTAAGCTATTTGT
TAAAGAATTCACGCATTCAAATATACCCTCTTCTTTTTTTTCTGATACCACAAAAATACCCGACTTACCA
CAAGATGCAACTGTTTTGATTAATCAAATAAATAGTGTTCTAGATTATAATGAAAAAGCGACATTGCTTA
TTTTAAAAGATCCCGTAGGATACCAAAAAGATGTTTTATCTTATTATAATATTGTAACAAAATTACATTT
ATTATATCAGAACTATTATAGCCATCCGGATAAAATTGGCCAATTTATTACGAGTATACAAGAAGCTAGT
CATCACATTAAAGATACTGATGAAAAAGAAAAAATGCAAACAATACTAAAAGAGAGTATTAATCAGAATG
CATTAGATAATGAGTGGAAAAATATTCATAAAACATTTATTTTTTTTGAGAAACATCAACGTATTGTATT
ATCATTGTATGAAAGCTTTATGAATAATCCGGCAATCATTAATGAAAACGGTGGCTTAAAACATTATTTT
GATTATGCTTTTTCATATCACGAACGTATAACGAAAGAAGATGTCTTTAGTATTGATTTTTTTAAGGACC
TTAATCAAGCTTTTGATTTATATTTTGATTTAATATCTCCATTAATGAATTCTACCGAAGGACAAAGAAC
ATTAGATAAATTATATTCAATTAATGATGAAGAAAATAATAGCCTGTGGGTGGGAGTGACAAAGAAAGTA
ATTAGTCTTGTTGCTAATTCAAAAATTATGGACGCACTTTTAAATGCACAAGAATATGCAGAGAATATCG
AAAATTTTGTTAATAAGCTTGCGTTTATTTGCTCAGATAGCATTGGTTTTGCATTTACAAAAACAAGTAA
GATGCTTTCTCATTACGATATTAAAAATAGACTAATTAATACTAAGGGTATTGACTATTTAGCTCAAAAG
ATACTTCCGATGATACTGGCATTTTGCAACACAAAAATTTCATTAACCGAGTTTGTTAAATTATCGGGTA
ATGAGCTTAACCAGTGGGTGGAACAACTCCGTAAATTAACGGAACAAATAGTACCAAATCTGCAACATCC
TAAATTAAATAAGCTTTTTTCTTGGAAACAAAAAATAATAAATCTAGGCGAAGAGACTGCCGTTCTTATT
CCGAAGATTGAGATCACAGATATTACTAAAAATAAGATTTATATTTATGGTAAAGATGCATTACAGGTTT
CCACTAAGCTATTTTTAAACGGTTTCAGCATGATCACCGGATCAATCCAAGCTTATACATTACAAGGTAT
GAGTTTGTATGAACGTAATGACCCATTAAAACTATCCCCCTATAATCTGTATACAGCACAGATTATTGCG
AATTTATTTGTAGCAAGCTACAGTATTTTAAAAGTTTCTCAAGAGGCGACAAAATTATCTCAAACAGTAT
CGAGCACCACACTGAAATTCTTTTTAGATAAAATAAAATTACCTATGCTAACAACAGAAGTGGGAACCAA
AAGAATGGCAGCATTAGGTAAGATTGCAGGTGCCGTTGGTGTTGCTCTTGCCACTCGAGATGCATTAGAA
GCTTTTCATATTGGAAATAATAAACAAGGTTTATCAAATGTAGCCATTGCCATTGGTTCTTTCATGCTAA
TTTTTGTTACAGGGGGATGGGCTCTATTTGCAGGACTGCTAATATTAGGAGGCTTCTTCTCAAGTCAACT
CACCAGTTGGAGTCATTTGGAAACTTTGCTAAGGCACAGTTTTTGGGGAAATGAAGAAAGTTCAAATTTT
TGGGATAATAATAGACCAACACCGATAGGAGAACAATTAAAACAATATATAAAAGAATTTGAATTCTATG
AACAAAAAGGGCTAATTGAATTACAAGAGTTTTATAATCTATTTTATACAGCTAAAATGACTCAAGAAAA
AATACCAAATGGAAAACTCCGCTTATCTTTTGAATTTACTAATTTTACCCCAGGGATTTCAGAAGTATAT
TTTCACTTTGTTACAGAGGTTGGTTATCACAGCGGCTTGGCAGAAGAAATAAAAACACCTAGTTCAGCTT
ATGTTCTAAATAAACGAAAAGACCTCTTAGAAATTAGCGAACAATTAAAAATGGCAAGTGAAAAAGGTGA
TTGGAACCCTGAAACAGGTATATTGAAATTTAGTTTGGAAGTACAGTCTCAATTAGTAAATACATATTCT
GCTTTTGGTGCACATCCTAATAGCCGTATAGGTATTGAAGATTTATATTGGTATTATCAAGTCAATCCCG
AGGTAACAACACCGATGCGTTATATCAATTGGGGGGGAGATACCCAAGAAAACAATCGGCTTTTAGGCTT
TATTAACAGTGAGAATATCTAA