SecReT6
Effector Protein ID: 197337277
-
SecReT6 ID300
T6SS typeA1
Gene symbol-
Locus tagVFMJ11_A0831
StrainVibrio fischeri MJ11
Repliconchromosome II [GenBank: NC_011186] [Browse all T6SS(s) in this replicon]
Location [Strand]918192..918710 [-]
ProductBfdA
Effector typeProtein
Homologous effectorVEPGS_0021
DescriptionHcp protein
UniProt IDB5EUL2
KEGG IDvfm:VFMJ11_A0831
PDB IDNA
Domain hit(s) vs Pfam DUF796 [PF05638], Evalue: 1.70E-35, Aligned region: 6..156
Protein Sequence: 172 a.a.     [Download]
>gi|197337277|ref|YP_002158380.1| BfdA [Vibrio fischeri MJ11]
MPTPAYMSIKGETQGDITKDAYSADSVGNVWQEAHVDEFLVQELDHVLTVPRDPQSGQPTGQRVHRPVVV
TKQQDRCSPLLFNSLVSGEKLPECNIKFYRTSTSGKQEHYYTIKLIDALLVDMQTRMAHCQDAAMSDRVT
EEVLKFTYRAIEVTHETCGTAGNDDWRTPREA
-
Nucleotide Sequence: 519 bp     [Download]
>gi|197336667|ref|NC_011186.1|:c918710-918192 Vibrio fischeri MJ11 chromosome II, complete sequence
ATGCCAACTCCAGCATATATGTCAATTAAAGGTGAAACTCAAGGCGATATTACTAAAGATGCTTATTCAG
CAGATTCAGTTGGTAACGTATGGCAAGAAGCACACGTTGATGAATTCCTTGTTCAAGAACTTGACCATGT
TTTAACTGTTCCACGTGATCCTCAAAGTGGTCAACCAACTGGTCAACGTGTACACCGTCCTGTAGTTGTA
ACTAAACAACAAGACCGTTGTTCTCCATTACTATTTAACTCATTAGTGTCTGGTGAAAAACTTCCTGAGT
GTAATATTAAATTCTACCGTACGTCGACTTCAGGTAAGCAAGAGCATTACTACACAATCAAACTGATTGA
TGCACTACTAGTTGATATGCAAACTCGTATGGCTCACTGCCAAGATGCTGCAATGTCTGATCGTGTAACT
GAAGAAGTGCTTAAGTTTACTTACCGTGCAATTGAAGTGACTCACGAAACATGTGGCACTGCTGGTAATG
ACGACTGGCGTACACCACGCGAAGCGTAA