SecReT6
Effector Protein ID: 197337584
-
SecReT6 ID300
T6SS typeA1
Gene symbol-
Locus tagVFMJ11_A1070
StrainVibrio fischeri MJ11
Repliconchromosome II [GenBank: NC_011186] [Browse all T6SS(s) in this replicon]
Location [Strand]1186939..1187457 [-]
Producthemolysin co-regulated protein
Effector typeProtein
Homologous effectorPSPTO_5435
DescriptionHcp protein
UniProt IDB5EVA0
KEGG IDvfm:VFMJ11_A1070
PDB IDNA
Domain hit(s) vs Pfam DUF796 [PF05638], Evalue: 1.00E-39, Aligned region: 6..156
Protein Sequence: 172 a.a.     [Download]
>gi|197337584|ref|YP_002158618.1| hemolysin co-regulated protein [Vibrio fischeri MJ11]
MPTPAYMRIEGEKQGLITAGTFTEDSVGNIYQEGHEDEVLVQGFEHQVLLPRDPQSGQPTGQRVHKPVRI
TKVFDKASPLMYNALTSGEKLPKVEIKWYRTSATGTQEHYFTTVLHDAIIVDITASMPNCQDPSQAHFTH
LEDVFMTYRAIDWTHEVAGTSGNDDWRTAMKA
-
Nucleotide Sequence: 519 bp     [Download]
>gi|197336667|ref|NC_011186.1|:c1187457-1186939 Vibrio fischeri MJ11 chromosome II, complete sequence
ATGCCAACTCCAGCTTATATGCGCATTGAAGGCGAAAAACAGGGACTAATTACTGCAGGTACATTTACTG
AAGATTCAGTAGGTAACATTTACCAAGAAGGTCATGAAGACGAAGTGTTAGTTCAAGGATTTGAACACCA
GGTTTTATTACCTCGTGATCCTCAATCAGGTCAGCCTACTGGTCAACGTGTGCATAAGCCTGTACGTATT
ACAAAAGTATTCGATAAGGCATCACCACTAATGTATAACGCATTAACGTCTGGTGAGAAACTGCCTAAAG
TTGAGATTAAGTGGTACCGTACTTCTGCAACAGGTACACAAGAGCACTATTTCACAACAGTTCTACACGA
TGCGATTATCGTTGATATCACAGCGTCAATGCCTAACTGTCAAGATCCATCACAAGCGCATTTCACACAC
CTAGAAGATGTATTTATGACATATCGTGCCATTGATTGGACGCATGAAGTCGCAGGTACATCAGGTAACG
ATGACTGGCGTACAGCAATGAAAGCGTAA