SecReT6
Effector Protein ID: 197363530
-
SecReT6 ID297
T6SS typeA3
Gene symbol-
Locus tagSSPA2322
StrainSalmonella enterica subsp. enterica serovar Paratyphi A str. AKU_12601
Repliconchromosome [GenBank: NC_011147] [Browse all T6SS(s) in this replicon]
Location [Strand]2585778..2586263 [-]
Productcytoplasmic protein
Effector typeProtein
Homologous effectorSTM0277
DescriptionTae4_TM
UniProt IDB5BDV0
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam DUF4285 [PF14113], Evalue: 2.10E-26, Aligned region: 40..141
Protein Sequence: 161 a.a.     [Download]
>gi|197363530|ref|YP_002143167.1| cytoplasmic protein [Salmonella enterica subsp. enterica serovar Paratyphi A str. AKU_12601]
MNRPSFNAAWLAFRKVNHSVADVGSIIGGNVGKNITGGYFQNACPIRMGYVLNATGFPIARNSPYAKVSG
ADNKFYIYRVNDMIDHLTHTMGKPDLIVNNPKQSDFIGKKGIIVVKGHGWSNARGHVTLWNGSICSDQCH
LLNDPDNGPFVPEVGTLWILP
-
Nucleotide Sequence: 486 bp     [Download]
>gi|197361212|ref|NC_011147.1|:c2586263-2585778 Salmonella enterica subsp. enterica serovar Paratyphi A str. AKU_12601 chromosome, complete genome
ATGAACAGACCTTCATTCAATGCAGCGTGGCTAGCTTTTAGGAAGGTGAATCATTCCGTCGCTGATGTGG
GTAGCATTATTGGTGGAAACGTTGGGAAAAATATAACTGGTGGTTATTTTCAAAATGCCTGCCCTATTCG
AATGGGCTATGTTTTGAATGCGACAGGATTCCCAATAGCCCGTAACTCTCCGTATGCAAAGGTTAGTGGT
GCCGATAATAAATTTTATATTTATCGAGTGAATGATATGATTGATCATCTTACTCATACTATGGGCAAGC
CCGATCTTATTGTTAATAATCCGAAACAGAGTGACTTTATAGGGAAGAAAGGAATTATCGTAGTAAAAGG
GCATGGCTGGAGCAATGCCAGAGGACACGTTACATTATGGAATGGCAGTATCTGTTCAGATCAGTGCCAC
TTATTAAATGACCCAGATAATGGACCATTTGTTCCTGAAGTTGGGACTCTGTGGATACTGCCGTGA