SecReT6
Effector Protein ID: 198243473
-
SecReT6 ID302
T6SS typeA1
Gene symbol-
Locus tagSeD_A3476
StrainSalmonella enterica subsp. enterica serovar Dublin str. CT_02021853
Repliconchromosome [GenBank: NC_011205] [Browse all T6SS(s) in this replicon]
Location [Strand]3338034..3338519 [-]
Producthypothetical protein
Effector typeProtein
Homologous effectorHcp
DescriptionHcp protein
UniProt IDB5FUZ5
KEGG IDsed:SeD_A3476
PDB IDNA
Domain hit(s) vs Pfam DUF796 [PF05638], Evalue: 2.20E-38, Aligned region: 5..135
Protein Sequence: 161 a.a.     [Download]
>gi|198243473|ref|YP_002217107.1| hypothetical protein SeD_A3476 [Salmonella enterica subsp. enterica serovar Dublin str. CT_02021853]
MDAIFLKLDNIKGESQVEGFEDQIEIMSYSHNVAMQVNNDVSLTERTSGRAHVGEMSLTKFVDLATPVLN
EYCCSGRLIRTAVLTLCRNDDGKMRSLIVYTLTNVLISQLSVSGGAGGKPVETMSLNFTKIEWQITAEKS
DGAQQESRTSVWDLAMDQIGK
-
Nucleotide Sequence: 486 bp     [Download]
>gi|198241740|ref|NC_011205.1|:c3338519-3338034 Salmonella enterica subsp. enterica serovar Dublin str. CT_02021853 chromosome, complete genome
ATGGATGCGATTTTTTTAAAGCTCGACAATATCAAAGGCGAAAGCCAGGTTGAAGGCTTTGAAGATCAGA
TAGAGATCATGTCTTATAGCCACAATGTGGCAATGCAGGTAAATAACGATGTTAGCCTCACTGAGCGGAC
TTCCGGGCGCGCGCATGTTGGTGAAATGTCGCTCACCAAATTTGTCGACCTCGCCACGCCTGTGCTCAAT
GAGTACTGCTGTAGCGGGAGGCTAATTAGAACCGCGGTGCTGACGTTGTGCCGCAATGACGACGGCAAAA
TGCGGTCGCTTATCGTTTATACCCTGACAAACGTGCTGATATCACAACTCAGTGTTAGCGGCGGCGCCGG
CGGTAAGCCGGTGGAAACGATGTCGCTGAACTTCACGAAAATCGAATGGCAAATCACTGCCGAGAAATCA
GACGGCGCTCAGCAGGAGTCCAGAACGTCAGTATGGGATCTGGCGATGGACCAGATAGGGAAATGA