SecReT6
Effector Protein ID: 198244078
-
SecReT6 ID301
T6SS typeA3
Gene symbol-
Locus tagSeD_A0300
StrainSalmonella enterica subsp. enterica serovar Dublin str. CT_02021853
Repliconchromosome [GenBank: NC_011205] [Browse all T6SS(s) in this replicon]
Location [Strand]317961..318446 [+]
Producthemolysin-coregulated protein
Effector typeProtein
Homologous effectorSciK
DescriptionHcp protein
UniProt IDB5FJ70
KEGG IDsed:SeD_A0300
PDB IDNA
Domain hit(s) vs Pfam DUF796 [PF05638], Evalue: 4.70E-40, Aligned region: 6..136
Protein Sequence: 161 a.a.     [Download]
>gi|198244078|ref|YP_002214231.1| hemolysin-coregulated protein [Salmonella enterica subsp. enterica serovar Dublin str. CT_02021853]
MAYDIFLKIDGIDGESMDDKHKNEIEVLGWRWNIHQESTMHAGSGLGSGKVSVTNLEFEHYIDRASPNLF
KYCASGKHIPQAILVMRKAGGNPLEYLKYTFTDLIVAVVSPSGNREGEIASRERIELSFSIVKQEYVVQN
QQGGSGGTITAGYDFKANKEI
-
Nucleotide Sequence: 486 bp     [Download]
>gi|198241740|ref|NC_011205.1|:317961-318446 Salmonella enterica subsp. enterica serovar Dublin str. CT_02021853 chromosome, complete genome
ATGGCTTATGACATTTTTTTGAAAATTGACGGCATTGACGGCGAGTCAATGGATGACAAACACAAAAATG
AAATTGAAGTACTGGGCTGGCGCTGGAATATTCATCAGGAATCCACCATGCACGCCGGTAGTGGCCTCGG
CTCCGGTAAGGTCTCTGTCACTAATCTGGAATTCGAGCATTATATCGATCGCGCCAGCCCGAATCTGTTC
AAATACTGTGCCTCCGGTAAGCACATTCCGCAGGCCATTCTGGTTATGCGTAAGGCTGGCGGCAACCCGT
TGGAGTACCTCAAGTACACCTTTACCGATCTGATCGTTGCGGTCGTTTCACCTAGCGGTAACAGAGAAGG
CGAAATCGCGTCTCGCGAGCGGATTGAGCTCTCCTTCAGCATCGTGAAGCAGGAATACGTGGTGCAGAAC
CAGCAGGGTGGCAGCGGCGGCACCATCACCGCAGGCTACGACTTCAAGGCCAACAAAGAAATTTAA