SecReT6
Effector Protein ID: 206559721
-
SecReT6 ID292
T6SS typeA4b
Gene symbol-
Locus tagBCAL1355
StrainBurkholderia cenocepacia J2315
Repliconchromosome I [GenBank: NC_011000] [Browse all T6SS(s) in this replicon]
Location [Strand]1484514..1487309 [+]
Producthypothetical protein
Effector typeProtein
Homologous effectorBTH_I2705
Descriptiontype VI secretion system Vgr family protein
UniProt IDB4E676
KEGG IDbcj:BCAL1355
PDB IDNA
Domain hit(s) vs Pfam Phage_GPD [PF05954], Evalue: 4.00E-50, Aligned region: 37..355
DUF2345 [PF10106], Evalue: 2.30E-41, Aligned region: 739..899
T6SS_Vgr [PF13296], Evalue: 3.10E-32, Aligned region: 578..686
Phage_base_V [PF04717], Evalue: 2.50E-18, Aligned region: 422..518
Protein Sequence: 931 a.a.     [Download]
>gi|206559721|ref|YP_002230485.1| hypothetical protein BCAL1355 [Burkholderia cenocepacia J2315]
MSVITEFASLFGAFNRLYSLDGSGALAAFQIERWTGRESLSDLFEWNVDALSTDPALDLDAMLGQRVAIR
TTLANGTTTLRSGLVAEAECRGYDAGLARYHLRIVPWLAALAHARDERTFVNQTLADVLDTVFAPYAGIA
RWRLTPDAGRRLDALGPTAYRVQYRTHTHYEFVQHLLAEAGLGFCFVEDEDAPAGHTMLVFDDSAQLAED
DTSARRGGVPRRSSGTATGADDVILGIGQSLSLTADRITLISSDYRVNRATTASTTLGRPAGARELYDDV
GPEAFDSLREAEDTVRRQADAIVSRASFWTGYGTLRTARAGRALKLVDAGWQPVRGAAAPEDFLLTRVEH
VGINNLPATVMEAIERRLGPLPAAALDPRVVRQAQAGGYANRFDAVPRTQVWRPTLADGTGQRLNPVPTA
LGAQTAIVVGPAGDARPGSTGPVHADAQGRLRVRFHWQAQDDAGTYPTRAIQRLASDGHGLQQLPRIGHE
VLVQFHHGLIHRPIVLGGLFNGRGEGGESPSPGGAAGKPLDASIYTQAGDHAPSAQGNLASGLSPAWHGA
GGGTDRHNHAGALSGFKSQGFDGHGHNQLVADDSDGMGRLQMATTHAATQLNLGHLRHQADNYLGSFRGQ
GVELRSDAYGAMRATRGLLVSSYAPAGAAQPAGDASALQALLARHTALVRRFDQTADTHGTLPFAARRGV
EQAGQSSLNGSAAPLDALAQSFATTVGANGYTQASADAAQRSTGNALPHTGDAVLGIEARGGHGLVAGQA
LQWAAGETLSLGSGGDFNLAAAQQLRIHSGQGIGWLAGASHAERVGIGMIAGKDGLTLQAQRDVLGLHAR
DDLTLASASADVEIAAKKTVHLAVSGGAHVTIEGGDVTFGCPGKFVVYAAQHAFVGPAQLNTPLPQFPEK
VCVECLLHAMQSGSALAGKAI
-
Nucleotide Sequence: 2796 bp     [Download]
>gi|206558403|ref|NC_011000.1|:1484514-1487309 Burkholderia cenocepacia J2315 chromosome 1, complete sequence
ATGAGCGTCATCACGGAATTTGCGTCTCTTTTTGGCGCATTCAATCGCCTGTATTCGCTGGACGGATCGG
GCGCGCTTGCGGCATTTCAAATCGAGCGCTGGACCGGCCGCGAATCGCTCTCCGATCTCTTTGAATGGAA
CGTCGATGCGCTGTCGACGGATCCTGCACTGGATCTCGACGCGATGCTCGGGCAGCGTGTCGCGATTCGC
ACCACGCTCGCGAACGGCACGACGACGCTGCGCAGCGGTCTCGTCGCCGAGGCCGAGTGCAGGGGCTACG
ACGCAGGCCTCGCTCGCTACCATCTCCGGATCGTGCCGTGGCTTGCCGCACTCGCGCATGCGCGCGACGA
GCGAACCTTTGTGAACCAGACGCTTGCCGACGTGCTCGACACGGTGTTCGCGCCGTACGCCGGGATCGCG
CGGTGGCGTCTCACGCCGGATGCTGGCCGGCGGCTCGATGCGCTGGGCCCCACTGCGTATCGCGTGCAGT
ACCGAACCCATACGCACTACGAATTCGTGCAGCATCTGCTGGCCGAGGCTGGCCTCGGGTTCTGCTTCGT
CGAAGACGAGGACGCGCCTGCCGGGCATACGATGCTGGTCTTCGACGACAGCGCGCAACTGGCCGAGGAC
GATACGTCCGCGCGACGCGGCGGGGTGCCGCGCCGCTCGAGCGGGACGGCGACCGGCGCCGACGACGTGA
TCCTCGGGATCGGGCAGTCGCTGTCGCTGACGGCCGATCGCATCACACTGATCAGCAGCGATTATCGCGT
GAACCGGGCGACTACCGCGAGTACGACGCTCGGCCGGCCGGCGGGCGCGCGCGAACTCTACGACGACGTC
GGGCCGGAGGCGTTCGACAGCTTGCGCGAAGCGGAAGATACGGTAAGGCGCCAGGCCGATGCGATCGTGT
CGCGCGCCAGTTTCTGGACCGGCTACGGCACGCTGCGCACGGCGCGCGCAGGACGCGCGCTGAAACTCGT
CGATGCCGGCTGGCAGCCCGTGCGCGGCGCCGCGGCGCCCGAGGATTTTCTGCTGACGCGCGTCGAGCAC
GTCGGGATCAACAATCTGCCGGCGACCGTCATGGAGGCCATCGAACGGCGACTCGGGCCGTTGCCGGCGG
CGGCGCTCGATCCGCGCGTGGTCCGGCAAGCGCAGGCCGGCGGTTATGCAAACCGGTTCGATGCGGTGCC
GCGAACGCAGGTCTGGCGGCCCACGCTGGCCGACGGAACCGGGCAGCGACTCAATCCGGTTCCGACGGCA
CTGGGTGCGCAGACGGCGATCGTCGTCGGGCCGGCCGGCGACGCACGGCCCGGTTCGACGGGGCCCGTGC
ACGCCGATGCGCAGGGGCGGTTGCGCGTTCGCTTCCACTGGCAGGCGCAAGACGATGCGGGTACGTATCC
GACGCGCGCCATACAACGGCTCGCGAGCGACGGGCACGGCCTTCAGCAGCTGCCGCGCATCGGTCATGAA
GTCCTCGTGCAGTTTCACCATGGGCTGATCCACCGGCCGATCGTGCTCGGCGGCCTGTTCAATGGCCGCG
GCGAAGGCGGCGAGTCGCCTTCGCCGGGCGGGGCGGCCGGCAAGCCGCTCGACGCGTCGATCTACACGCA
GGCGGGCGATCATGCGCCGAGCGCGCAGGGCAATCTGGCAAGCGGGCTGAGCCCCGCGTGGCATGGCGCC
GGCGGCGGCACCGATCGTCACAATCACGCCGGCGCGCTGTCGGGCTTCAAGAGCCAGGGTTTCGACGGGC
ATGGCCACAACCAGCTCGTCGCCGATGATTCGGACGGCATGGGACGCCTGCAGATGGCGACTACGCACGC
GGCCACGCAACTGAACCTCGGTCATCTGCGCCATCAGGCGGACAACTATCTCGGCAGTTTTCGTGGCCAG
GGCGTCGAATTGCGCTCGGATGCGTACGGTGCAATGCGTGCGACGCGCGGCCTGCTGGTGTCGAGCTACG
CGCCTGCCGGCGCCGCCCAGCCGGCGGGCGATGCGTCCGCGCTGCAGGCGCTGCTCGCGCGGCACACCGC
ATTGGTTCGGCGATTCGACCAGACGGCCGATACGCATGGGACGCTGCCGTTCGCCGCACGGCGCGGCGTG
GAGCAGGCGGGCCAGTCGTCGTTGAACGGCAGCGCCGCGCCGCTGGATGCGCTTGCGCAGAGCTTCGCGA
CGACGGTCGGCGCGAACGGCTACACGCAGGCGTCGGCCGACGCCGCCCAGCGGTCGACCGGCAACGCACT
GCCGCACACGGGCGACGCCGTGCTCGGCATCGAGGCACGGGGCGGGCACGGGCTGGTTGCCGGCCAGGCC
CTGCAATGGGCGGCCGGCGAAACGCTGTCGCTCGGCAGCGGTGGCGACTTCAATCTCGCCGCTGCGCAGC
AGCTGCGCATTCACAGCGGGCAAGGCATCGGCTGGCTGGCCGGCGCGAGCCATGCGGAGCGTGTCGGCAT
CGGCATGATCGCCGGCAAGGACGGACTGACGCTGCAGGCGCAGCGCGATGTGCTGGGCCTGCACGCGCGC
GACGATCTGACGCTCGCGTCCGCGAGCGCGGACGTCGAGATCGCCGCGAAGAAGACCGTGCATCTCGCGG
TGAGCGGAGGGGCGCACGTGACGATCGAAGGTGGCGACGTCACGTTCGGTTGCCCGGGCAAATTCGTCGT
GTATGCCGCGCAGCATGCATTCGTGGGGCCCGCTCAACTGAATACGCCGTTGCCGCAGTTTCCCGAAAAG
GTCTGTGTCGAATGCCTGCTGCACGCGATGCAGTCGGGCAGCGCACTCGCGGGCAAGGCGATCTGA