SecReT6
Effector Protein ID: 206559724
-
SecReT6 ID292
T6SS typeA4b
Gene symbol-
Locus tagBCAL1358
StrainBurkholderia cenocepacia J2315
Repliconchromosome I [GenBank: NC_011000] [Browse all T6SS(s) in this replicon]
Location [Strand]1488856..1491255 [+]
Producthypothetical protein
Effector typeProtein
Homologous effectorBTH_I2698
DescriptionTle1
UniProt IDB4E679
KEGG IDbcj:BCAL1358
PDB IDNA
Domain hit(s) vs Pfam DUF2235 [PF09994], Evalue: 2.60E-54, Aligned region: 42..140
DUF2235 [PF09994], Evalue: 2.60E-54, Aligned region: 260..281
DUF2235 [PF09994], Evalue: 2.60E-54, Aligned region: 285..409
Protein Sequence: 799 a.a.     [Download]
>gi|206559724|ref|YP_002230488.1| hypothetical protein BCAL1358 [Burkholderia cenocepacia J2315]
MSFRFASADRPDVGVVTREEQDAIMRRLHDDDGMSCCKTLHVGIFFDGTRNNADRDRTGGKHSNVARLFD
VFPRDKYHSAIYVAGVGTPFVDEIGDQGVGLQAAAGAATGWAGEGRINWALLQIHNVVHAHAFGNSLSAA
LGKSDKELAKAVSVDLNFKGIDLGGTPPKPGSLGDINARGSSSVGALKLMAAEQNGIELTWDRDTIWAQL
KGEVDTANWTATMRAWDEKRRVALRARCAQLKVRVGDLLVKGKPKLQRIRLYVFGFSRGAAEARTFSNWL
ADALDPDFSLCGVPVSYDFLGIFDTVASVGIAQSTAATLFDGHGGWGRKELMGVPRYVRRCVHMVAAHEP
RGSFPLDLIDASRDGHEEIVYPGVHSDVGGGYGPGEQGRGTGDADKLSQVPLLDMYREARKAGVPLDIKG
PGVAAEAAAAFAISPALKRAFSAYVSTSADYYYAKEHGTPGLMRAHYGLYLRWRKMRLDNLRSQPSFLAA
KAAYPQDAVDLDSANEELRLEWRDLLECEKEGGPTVSRYAGNTVSRKITQNPKAAAVISPAVLPIAAGLQ
SAIPFVGPLVRASAKRAEDFFQLQLEEKWKQWLEVRGDWNMGPPEAPISALYDNFMHDSRAWFKPLGDDD
DVWNHNQIKALKTRQAEFERKHAEWKKRQQLGVPGPSQIMQMMGAGALGLGPAANVAPEPEPRSPLTAQQ
AGILKRYDAAQQAAQKARAARDATAPTDSAVLTDPKVTGGLALQDSGREFSFVWGYLRWRTVYVNGVRWD
APHVPSVQEDMEAMRQQMQRNVDMSKLFR
-
Nucleotide Sequence: 2400 bp     [Download]
>gi|206558403|ref|NC_011000.1|:1488856-1491255 Burkholderia cenocepacia J2315 chromosome 1, complete sequence
ATGAGTTTCCGCTTCGCGAGCGCCGACCGGCCTGACGTCGGCGTCGTCACCCGGGAGGAGCAGGACGCGA
TCATGCGTCGGCTGCACGACGACGACGGGATGAGTTGCTGCAAGACGCTGCATGTCGGCATCTTCTTCGA
CGGCACGCGCAACAACGCCGATCGCGATCGCACGGGCGGCAAGCACAGCAACGTCGCGCGGCTGTTCGAC
GTGTTTCCGCGCGACAAGTATCACAGTGCCATTTACGTGGCCGGCGTCGGCACGCCGTTCGTCGACGAGA
TCGGCGACCAGGGCGTCGGACTGCAGGCCGCGGCCGGCGCGGCGACGGGATGGGCCGGCGAGGGGCGCAT
CAACTGGGCGCTGCTGCAGATCCACAACGTCGTGCATGCGCACGCGTTCGGCAATTCGCTGTCCGCGGCG
CTCGGCAAGAGCGACAAGGAACTCGCGAAGGCCGTCAGCGTCGACCTGAATTTCAAGGGCATCGATCTCG
GCGGCACTCCGCCCAAGCCGGGCAGTCTCGGCGACATCAACGCGCGCGGCAGTTCGAGCGTCGGTGCGCT
CAAGCTGATGGCCGCCGAGCAGAACGGGATCGAACTGACCTGGGATCGCGACACGATCTGGGCGCAGCTC
AAGGGCGAAGTCGATACGGCGAACTGGACCGCGACGATGCGCGCATGGGACGAGAAACGCCGCGTCGCAT
TGCGGGCCCGGTGCGCGCAGCTGAAGGTGCGCGTCGGCGATCTGCTGGTGAAGGGCAAGCCGAAACTGCA
GCGCATTCGGCTGTACGTGTTCGGTTTTTCGCGCGGGGCGGCCGAGGCCCGCACGTTCTCGAACTGGCTG
GCCGATGCGCTGGACCCCGATTTCAGCCTGTGCGGCGTGCCCGTGTCTTACGACTTTCTCGGCATCTTCG
ATACGGTCGCGTCGGTCGGCATCGCGCAAAGCACGGCCGCGACGCTGTTCGACGGGCACGGCGGCTGGGG
GCGCAAGGAACTGATGGGCGTGCCGCGCTACGTGCGCCGCTGCGTCCATATGGTCGCCGCCCACGAGCCG
CGCGGATCGTTCCCGCTCGACCTGATCGATGCGTCGCGGGACGGGCATGAGGAAATCGTCTATCCGGGCG
TGCATTCGGATGTCGGCGGCGGTTACGGGCCAGGCGAGCAGGGGCGCGGCACCGGCGACGCGGACAAGCT
GTCGCAGGTGCCGCTGCTCGACATGTATCGCGAAGCGCGCAAGGCCGGTGTTCCACTCGATATCAAGGGG
CCCGGTGTCGCTGCCGAAGCCGCGGCGGCATTCGCGATTTCTCCCGCGCTCAAGCGCGCCTTTTCCGCCT
ATGTGAGCACGAGCGCCGACTATTACTACGCGAAGGAGCACGGCACGCCGGGCCTGATGCGCGCGCACTA
CGGGCTTTACCTGCGCTGGCGCAAGATGCGGCTCGACAATTTGCGTTCGCAACCGTCGTTTCTCGCCGCC
AAGGCTGCCTATCCGCAGGATGCCGTCGATCTCGACAGCGCGAACGAGGAACTGCGGCTTGAATGGCGCG
ACCTGCTCGAATGCGAGAAAGAAGGCGGACCGACCGTGAGCCGGTACGCGGGCAACACGGTCAGCCGGAA
GATCACCCAGAACCCGAAGGCGGCGGCCGTCATTTCGCCGGCCGTCCTGCCGATCGCCGCGGGCCTGCAG
TCCGCGATTCCGTTCGTGGGCCCGCTCGTGCGCGCGAGCGCCAAGCGCGCCGAGGATTTCTTCCAGCTGC
AGCTCGAAGAGAAATGGAAGCAGTGGCTCGAGGTGCGCGGCGACTGGAACATGGGGCCGCCGGAAGCGCC
GATCAGCGCGCTGTACGACAACTTCATGCATGACTCGCGCGCATGGTTCAAGCCGCTGGGCGACGACGAC
GACGTGTGGAACCACAACCAGATCAAAGCGCTGAAAACGCGCCAGGCCGAGTTCGAGCGCAAGCACGCCG
AGTGGAAGAAGCGCCAGCAACTTGGCGTGCCGGGACCGTCGCAGATCATGCAGATGATGGGGGCGGGTGC
GCTCGGGCTCGGGCCGGCCGCCAACGTCGCGCCGGAGCCCGAACCGCGTTCGCCGCTGACCGCGCAGCAG
GCCGGCATCCTGAAACGTTACGACGCCGCGCAGCAGGCTGCACAGAAAGCCCGCGCGGCCCGGGATGCCA
CCGCGCCGACCGACAGCGCCGTGCTGACCGACCCGAAAGTCACCGGTGGTCTCGCGCTGCAGGATTCGGG
GCGCGAGTTTTCGTTCGTCTGGGGCTACCTGCGCTGGCGCACCGTCTACGTGAACGGCGTGCGCTGGGAC
GCGCCCCATGTGCCGAGCGTGCAGGAAGACATGGAGGCGATGCGTCAGCAGATGCAGCGCAACGTCGACA
TGAGCAAGCTGTTCCGATGA