SecReT6
Effector Protein ID: 206559725
-
SecReT6 ID292
T6SS typeA4b
Gene symbol-
Locus tagBCAL1359
StrainBurkholderia cenocepacia J2315
Repliconchromosome I [GenBank: NC_011000] [Browse all T6SS(s) in this replicon]
Location [Strand]1491317..1495018 [+]
Producthypothetical protein
Effector typeProtein
Homologous effectorBTH_I2697
Descriptiontype VI secretion system Vgr family protein
UniProt IDB4E680
KEGG IDbcj:BCAL1359
PDB IDNA
Domain hit(s) vs Pfam Phage_GPD [PF05954], Evalue: 1.50E-55, Aligned region: 35..340
DUF2345 [PF10106], Evalue: 9.00E-48, Aligned region: 667..820
T6SS_Vgr [PF13296], Evalue: 2.20E-29, Aligned region: 516..623
Phage_base_V [PF04717], Evalue: 3.20E-15, Aligned region: 384..496
Phage_base_V [PF04717], Evalue: 3.20E-15, Aligned region: 997..1011
Protein Sequence: 1233 a.a.     [Download]
>gi|206559725|ref|YP_002230489.1| hypothetical protein BCAL1359 [Burkholderia cenocepacia J2315]
MDLVAALTGYGQATRHIQIDTAMPDAFVVERFHGREGISESFRFEIDVLSSEPFLDLAPLIGSAVRLRLA
TAAGERCWNGYVTHAAYAESDGEFTRYRLTMESWLALLKLRRNCLYFVDLDAEGICERVFGDYPEAHWRY
ELVEPLRSFRLRGQYRETDLDFVSRQLSEAGLSFRIEHGQDAGKAPSGDHTVVVFDRHARLPDGSAIAFN
AQDVGDPDGVMTQFSDRRQLVPDRVVATSWKASELHALAGHAQQPADADAPLLPVREIYDGQRAGRFDTS
GDAQRYAEQRLDALQLAKRVYRGGGSSRTLETGKVHTLNDYLGGTVRFVPLSIEHEAVNNLGAQIGQLFG
RGELDKGLYRNRFVAVPEGTPIVPPFRDRPTVYGVQTAIVVGEPGGRVSSTRDHQVRIQFPWMRGVAPLP
GGLTDTASRSNPTGHAPGDHRSGILVRVAEQAAGPNFGHAFVPRVGAEVVVGFESGNIDAPVVLGQVYGG
RVRPPFSAGEGSDANHSGTLTGLQTQTLDGQPGSRWVMDDAAGQLRHELSNSTADTRLAQGYLIDQQGTM
RGAYRGEGFELATQGWGVVRAGAGVLMSSTARRLGVSTQMDVAERVEQLKGAAKTAQELDTAATGAQAAG
LSANKAQTDFLKAIDPAQDGKYAGSVGGQSATKPTGTQRDGGDPVERFATPVVLMESPENIVVTTPESAV
SYAAQHVHLTSQGDAHVGAGATVAAATGDAMSLYSVAGGLKAIAGEGPVSVEAHASTMEILADQTVRVTS
TDERVDVLAQDAIVLQQGPNRITLKGGDIVVETPGQFAVKAGGHPFPGPRATSVKLPALPVLPQGDPCDF
LVQALAASPAGRGAVAGGGSLVGAASSIVGATLPTASGAMGAAQAFSRAPGQPLPAPSAAAPTAAERGSG
PSLGYSTPPPVSSELEGMPKKGAAAHSGPCNLHVPAIKKEEHTVSMGAADYYETDEGGNPKLKNGQLNWL
QYAASTGTYDIGYAPATATLTATVRIKVHLKDQHWINQGRVHMDPATGKPFSVPYNSDGIRQGLIIRVVD
RPGGLAAVSGFKKRIEEGLNRGNYSMQPKACPLGKACTCKVKVKLEVELVQTGRCHAEINLFPKVTRANS
ENWGEVQVEWNPQQQRFVPVSTQNAIAHESGHLFGWPDEYFVDGGAVFGKYINSRHLVDVTMAQLDDNWQ
RTTETNLMGRGMYTQKPEIPKYYMYGFRDWFNEKTGIDWEVLK
-
Nucleotide Sequence: 3702 bp     [Download]
>gi|206558403|ref|NC_011000.1|:1491317-1495018 Burkholderia cenocepacia J2315 chromosome 1, complete sequence
ATGGATCTAGTTGCCGCATTAACGGGGTACGGGCAAGCGACCCGTCATATCCAGATCGATACCGCGATGC
CGGACGCATTCGTCGTAGAGCGCTTTCACGGTCGTGAAGGGATCAGCGAATCGTTCCGGTTCGAGATCGA
CGTGCTGTCGAGCGAGCCGTTTCTCGATCTCGCGCCGCTGATCGGCAGCGCCGTGCGGCTGCGTCTCGCG
ACGGCGGCGGGCGAACGATGCTGGAACGGCTACGTCACGCATGCCGCTTATGCGGAGAGCGACGGCGAGT
TCACGCGCTATCGGCTCACGATGGAATCGTGGCTCGCGCTGCTGAAGCTGCGCCGCAATTGCCTCTATTT
CGTCGACCTCGACGCCGAGGGGATCTGCGAGCGTGTGTTCGGCGACTATCCGGAAGCGCACTGGCGCTAT
GAACTCGTCGAGCCGCTGCGATCGTTTCGCTTGCGCGGCCAGTATCGCGAAACCGATCTCGATTTCGTGT
CGCGGCAGTTGTCCGAGGCCGGGTTGTCGTTTCGCATCGAGCACGGGCAAGACGCGGGGAAGGCGCCGTC
GGGCGACCATACCGTCGTTGTGTTCGACCGCCATGCGCGGCTGCCCGACGGCAGCGCCATCGCATTCAAT
GCGCAGGACGTCGGCGATCCGGACGGCGTGATGACGCAATTCTCCGATCGGCGTCAGCTGGTGCCGGATC
GCGTGGTGGCGACGAGCTGGAAAGCCAGCGAACTTCATGCGCTTGCCGGCCATGCGCAACAGCCCGCCGA
TGCCGACGCGCCGTTGCTGCCGGTGCGGGAGATCTACGACGGCCAGCGCGCAGGCCGCTTCGACACGAGC
GGCGATGCGCAGCGTTACGCCGAACAGCGTCTCGACGCGCTGCAGCTCGCGAAACGGGTCTACCGTGGCG
GCGGGTCGTCGCGCACGCTCGAAACCGGCAAGGTCCATACGCTGAACGACTATCTGGGCGGCACCGTGCG
ATTCGTACCGCTGTCGATCGAGCACGAGGCCGTCAACAACCTCGGCGCGCAGATCGGCCAGCTGTTCGGA
CGCGGCGAGCTCGACAAGGGGCTGTATCGCAACCGCTTCGTCGCGGTGCCGGAGGGCACGCCGATCGTGC
CGCCGTTCCGCGACCGGCCGACGGTGTACGGGGTGCAGACTGCGATCGTCGTCGGCGAGCCGGGTGGGCG
CGTCAGCAGCACGCGCGATCACCAGGTCCGCATCCAGTTTCCGTGGATGCGCGGTGTCGCGCCGCTGCCG
GGCGGGTTGACGGATACGGCAAGCCGGTCCAATCCGACCGGCCACGCGCCGGGCGATCACCGTTCGGGCA
TTCTGGTTCGCGTCGCCGAACAGGCGGCCGGGCCGAATTTCGGTCATGCGTTTGTACCGCGCGTGGGGGC
GGAAGTGGTGGTCGGCTTCGAGTCGGGCAACATCGATGCGCCGGTCGTGCTCGGCCAGGTGTACGGCGGG
CGTGTGCGTCCGCCGTTCTCCGCGGGCGAAGGCAGCGACGCGAATCATTCAGGAACACTGACGGGCCTGC
AGACGCAAACCCTCGATGGGCAACCCGGCAGTCGCTGGGTGATGGACGATGCGGCCGGACAACTGCGTCA
CGAGCTGAGCAATTCGACCGCCGACACGCGCCTCGCGCAGGGCTATCTGATCGACCAGCAGGGGACGATG
CGCGGCGCCTATCGCGGTGAAGGCTTCGAACTGGCGACGCAGGGATGGGGTGTCGTGCGGGCCGGCGCGG
GCGTGCTGATGTCGAGTACCGCGCGCCGGCTCGGCGTGTCGACGCAGATGGATGTCGCCGAACGCGTGGA
GCAATTGAAGGGCGCGGCGAAAACGGCGCAGGAACTCGACACGGCGGCGACCGGTGCGCAGGCGGCCGGC
CTGAGCGCGAACAAGGCGCAGACTGATTTCCTCAAGGCGATTGATCCTGCGCAGGACGGCAAGTACGCGG
GCAGCGTGGGTGGTCAGAGCGCGACCAAGCCGACCGGGACGCAGCGCGACGGCGGCGATCCCGTCGAGCG
ATTCGCGACGCCCGTGGTGCTGATGGAGTCGCCGGAGAACATCGTGGTGACGACGCCGGAGAGTGCGGTG
TCGTATGCGGCGCAGCACGTTCATCTGACGTCGCAAGGCGATGCGCATGTGGGCGCCGGTGCCACCGTGG
CCGCGGCGACGGGCGATGCGATGAGCTTGTACAGCGTGGCGGGCGGGCTCAAGGCAATCGCGGGCGAAGG
GCCGGTGAGCGTCGAGGCGCATGCGTCGACGATGGAGATTCTCGCGGACCAGACCGTGCGCGTGACGTCG
ACCGACGAGCGCGTCGACGTGCTCGCGCAGGACGCGATCGTGCTGCAGCAGGGGCCGAACCGGATCACGT
TGAAGGGTGGCGATATCGTCGTCGAGACGCCGGGGCAATTCGCGGTGAAGGCGGGCGGGCATCCGTTCCC
GGGGCCGCGGGCGACGAGCGTGAAGCTGCCGGCGCTGCCGGTGTTGCCGCAAGGCGATCCGTGCGACTTT
CTCGTGCAGGCGCTGGCGGCGAGTCCGGCGGGGAGAGGGGCGGTGGCAGGGGGCGGAAGTTTGGTGGGTG
CGGCGAGTTCGATCGTCGGTGCGACGCTACCGACAGCGAGCGGTGCCATGGGCGCGGCGCAGGCATTTTC
CCGTGCGCCCGGTCAACCGCTGCCCGCGCCTTCCGCGGCTGCACCCACGGCGGCGGAGAGGGGATCCGGT
CCCTCTCTCGGTTATTCGACGCCACCACCCGTGTCCAGTGAGCTGGAGGGCATGCCGAAAAAAGGTGCGG
CTGCGCACAGTGGACCGTGCAACCTTCACGTCCCCGCGATCAAGAAGGAAGAGCATACCGTCAGTATGGG
GGCCGCCGACTATTATGAGACGGATGAGGGCGGCAATCCGAAGTTGAAGAATGGGCAACTCAACTGGCTT
CAATATGCGGCATCGACCGGGACGTACGATATCGGCTATGCACCTGCGACGGCGACGTTGACGGCAACCG
TCCGTATCAAGGTTCATCTGAAGGATCAACACTGGATCAACCAGGGGCGCGTCCATATGGATCCGGCGAC
GGGCAAGCCGTTTTCGGTGCCGTACAACAGCGATGGCATACGGCAAGGCTTGATCATCAGGGTAGTGGAC
CGACCCGGTGGTCTTGCTGCCGTGTCGGGCTTCAAGAAGCGCATCGAGGAAGGACTGAACCGGGGGAATT
ACTCGATGCAGCCGAAGGCGTGTCCGCTCGGCAAGGCATGTACATGCAAGGTCAAGGTGAAACTTGAAGT
CGAACTCGTTCAAACCGGGAGATGCCATGCCGAGATCAATCTCTTTCCCAAGGTGACGCGAGCGAACTCG
GAGAATTGGGGGGAAGTGCAAGTCGAGTGGAACCCGCAGCAGCAACGGTTTGTCCCGGTATCGACCCAGA
ATGCGATCGCGCATGAGAGCGGGCACTTGTTCGGGTGGCCGGATGAGTACTTTGTTGACGGCGGCGCCGT
GTTCGGGAAGTACATCAACTCGCGACATCTGGTCGACGTGACGATGGCACAGCTCGACGACAACTGGCAG
CGCACCACCGAAACGAACTTGATGGGCCGCGGAATGTACACGCAAAAGCCGGAAATTCCGAAGTACTACA
TGTACGGCTTCCGTGACTGGTTCAACGAAAAGACCGGAATTGACTGGGAAGTGCTGAAATGA