SecReT6
Effector Protein ID: 206559727
-
SecReT6 ID292
T6SS typeA4b
Gene symbol-
Locus tagBCAL1362
StrainBurkholderia cenocepacia J2315
Repliconchromosome I [GenBank: NC_011000] [Browse all T6SS(s) in this replicon]
Location [Strand]1496284..1499088 [+]
Producthypothetical protein
Effector typeProtein
Homologous effectorBTH_I2693
Descriptiontype VI secretion system Vgr family protein
UniProt IDB4E682
KEGG IDbcj:BCAL1362
PDB IDNA
Domain hit(s) vs Pfam Phage_GPD [PF05954], Evalue: 1.60E-62, Aligned region: 42..355
Phage_GPD [PF05954], Evalue: 1.60E-62, Aligned region: 457..477
Phage_GPD [PF05954], Evalue: 1.60E-62, Aligned region: 572..653
DUF2345 [PF10106], Evalue: 3.30E-38, Aligned region: 643..679
DUF2345 [PF10106], Evalue: 3.30E-38, Aligned region: 739..903
T6SS_Vgr [PF13296], Evalue: 1.70E-23, Aligned region: 590..690
T6SS_Vgr [PF13296], Evalue: 1.70E-23, Aligned region: 724..769
T6SS_Vgr [PF13296], Evalue: 1.70E-23, Aligned region: 789..823
Phage_base_V [PF04717], Evalue: 8.00E-11, Aligned region: 334..355
Phage_base_V [PF04717], Evalue: 8.00E-11, Aligned region: 442..544
Protein Sequence: 934 a.a.     [Download]
>gi|206559727|ref|YP_002230491.1| hypothetical protein BCAL1362 [Burkholderia cenocepacia J2315]
MSTQSDLIQAFFRGWSQHDRFLWLTTPLGADKLVAESLQGWESLDRGGFRFQLTALTERPDLPLDKLIGA
SILIEWQVADGQGARRPFHGHVTAAERVGYNGGLARVRLVVEPWLALLHQRVDSYNFVNASVVEISEQIF
AHYARGAIAPAWRWALADPAKYANRSLTAQAGESDFAFLERLWAEEGIFYWFEHQGDAHSTDLGKHTLVL
ADTNQRFAPAEPEVIGFHQTSDGDPRGGIRQFMNARRWRIGSIARASWDHRSLSTRPSSVRASGAVAPGE
DRDVAGPYAFQTAAIGDQRAQQQLDAQRVAALQTEGSGTRRDLRPGLRFAMSRHPSLDPSRAFVCLRVEH
DARANVSADVHGAIAQRLGAIPPGLDIAPGEPGDAQALHAAFDATTHAGGALVDGDEVYRNRFAALPFDQ
AYRPLAPSGHGARVHPVAVMPGAQTSIVVGAGDPVHTERDHRIRIQHHAQRGQNSASRDEHPRAANAPAD
RGAGTWTRMVTSIGGDNWGGVSVPRVGQEVWTEWLEGQPDRPIAVAALYNGQGNADAQHNALAGGPSGST
ANAAAWFAGNDHAAVLTGFKTQDLNASQTGAGGSRQFMLDDTAGQSSARLYTTDHGSGLTLGHIKQVQDN
RRLADRGYGAELSTQAAAALRAGAGLLISTAPGVNQMDASAASQVLAQQREMLQGLAKFARKQGAEPGAS
TAQPDGVASVGDTTSPLVAIEGLQQSQVSLGATREGSGASGAGGGAVAWQHPHLVAHGAAGVAALTAQSH
VWTSGTQTVLSAGRDVQVTVQGKSSIVAKEGIALYTHGTPGGSRPVPAAGIALHAATGAVTVQAQNGGTL
DASAQRAVTVSSAKASVALQSPKRLLLTAANAFLKMEGNDIVIGAPGKATFHAAQHTLTGPRSANVQLPS
MNKPACVECMRDLAHRHEAIATRG
-
Nucleotide Sequence: 2805 bp     [Download]
>gi|206558403|ref|NC_011000.1|:1496284-1499088 Burkholderia cenocepacia J2315 chromosome 1, complete sequence
ATGTCGACCCAATCCGATCTCATCCAGGCATTCTTCCGCGGCTGGTCGCAGCACGACCGGTTTCTGTGGC
TGACCACGCCGCTCGGCGCGGACAAGCTTGTCGCCGAGAGCCTGCAAGGATGGGAGTCGCTCGATCGCGG
CGGCTTCCGGTTTCAGCTCACCGCGCTGACCGAGCGGCCCGACCTGCCGCTCGACAAACTGATCGGCGCG
TCGATCCTCATCGAATGGCAGGTCGCGGACGGGCAGGGCGCACGACGCCCGTTCCACGGCCATGTGACGG
CCGCGGAACGCGTCGGCTACAACGGCGGGCTCGCGCGTGTGCGGCTCGTCGTCGAACCGTGGCTCGCGCT
GCTGCATCAGCGCGTCGACAGCTACAACTTCGTGAACGCGAGCGTGGTCGAGATCAGCGAGCAGATCTTT
GCGCACTATGCGCGTGGCGCGATCGCGCCGGCATGGCGCTGGGCGCTTGCCGACCCGGCGAAATATGCGA
ACCGCAGCCTGACCGCACAGGCCGGCGAATCGGATTTCGCGTTTCTCGAACGACTGTGGGCGGAAGAGGG
CATCTTCTACTGGTTCGAACACCAGGGCGACGCGCACTCGACTGACCTGGGCAAACACACGCTCGTGCTG
GCCGATACGAACCAGCGTTTCGCCCCGGCTGAACCCGAAGTCATCGGCTTCCATCAGACGAGCGACGGCG
ACCCGCGCGGTGGCATTCGGCAATTCATGAATGCGCGCCGCTGGCGCATCGGCAGCATCGCACGCGCAAG
CTGGGATCACCGAAGCCTGTCGACCCGTCCGTCCAGCGTGCGTGCGAGCGGTGCGGTCGCGCCGGGCGAG
GATCGCGATGTCGCAGGCCCGTACGCGTTCCAGACCGCCGCGATCGGCGACCAGCGCGCGCAGCAGCAAC
TCGACGCGCAGCGCGTGGCGGCGCTGCAAACCGAAGGCAGCGGCACGCGTCGCGATTTGCGGCCCGGGCT
GCGTTTCGCGATGTCGCGGCATCCGTCACTCGATCCATCGCGCGCGTTCGTGTGCCTGCGCGTCGAGCAC
GACGCGCGTGCGAACGTGAGCGCCGACGTGCACGGCGCGATCGCGCAACGGCTCGGCGCGATTCCGCCGG
GACTCGATATCGCGCCCGGCGAGCCGGGCGACGCGCAGGCGCTGCACGCGGCATTCGACGCCACGACGCA
CGCCGGCGGCGCGCTGGTAGACGGCGACGAGGTGTACCGGAACCGCTTCGCCGCGCTGCCGTTCGACCAG
GCTTACCGGCCGTTGGCGCCGAGCGGGCATGGCGCACGCGTGCATCCGGTCGCGGTGATGCCGGGCGCCC
AGACGAGCATCGTGGTCGGCGCGGGCGATCCGGTTCATACCGAACGCGATCACCGGATCCGGATCCAGCA
TCATGCGCAGCGCGGGCAGAATTCCGCGAGTCGCGACGAACATCCGCGCGCGGCGAACGCGCCGGCCGAT
CGTGGCGCGGGCACCTGGACGCGCATGGTGACATCGATCGGCGGCGACAACTGGGGCGGGGTGAGCGTGC
CGCGCGTCGGTCAGGAAGTCTGGACCGAATGGCTGGAAGGCCAGCCCGACCGGCCGATCGCGGTCGCCGC
GCTGTACAACGGGCAAGGCAACGCGGACGCGCAGCACAATGCGCTGGCGGGCGGCCCGAGCGGCAGCACG
GCCAATGCGGCGGCCTGGTTTGCCGGCAACGACCACGCAGCCGTGCTGACCGGGTTCAAGACGCAGGATC
TGAATGCGAGTCAGACCGGCGCGGGGGGCTCGCGACAATTCATGCTTGACGATACGGCTGGGCAGTCGAG
TGCGCGCCTTTATACGACCGATCACGGCAGCGGCCTGACGCTCGGGCACATCAAGCAGGTGCAGGACAAC
CGGCGTCTGGCCGATCGCGGCTACGGCGCCGAACTGTCGACGCAGGCAGCCGCCGCGCTGCGCGCCGGCG
CCGGCTTGTTGATCAGCACGGCGCCCGGCGTGAACCAGATGGACGCGAGTGCCGCGAGCCAGGTGCTCGC
GCAGCAACGCGAGATGCTGCAGGGGCTTGCGAAATTCGCGCGCAAGCAGGGTGCGGAGCCGGGCGCGAGC
ACGGCGCAGCCCGATGGTGTCGCGTCTGTCGGCGACACGACATCGCCGCTCGTGGCGATCGAGGGCCTGC
AGCAAAGCCAGGTGTCGCTCGGCGCAACGCGCGAAGGCAGTGGCGCGAGCGGTGCCGGCGGCGGTGCGGT
TGCGTGGCAGCATCCGCATCTCGTCGCGCACGGCGCGGCCGGCGTCGCTGCGCTGACGGCGCAAAGCCAC
GTGTGGACGTCGGGCACGCAAACCGTACTGAGCGCCGGACGCGACGTGCAGGTCACGGTCCAGGGCAAGT
CGAGCATCGTCGCGAAGGAAGGCATTGCGCTGTACACGCACGGCACCCCGGGCGGCAGCCGTCCCGTGCC
GGCGGCCGGGATCGCGCTTCATGCTGCGACGGGCGCCGTCACCGTGCAGGCGCAGAACGGCGGCACGCTC
GACGCCAGTGCGCAGCGTGCGGTGACTGTATCGAGCGCGAAGGCAAGTGTCGCGCTGCAGTCGCCGAAGC
GGCTGCTGCTGACGGCGGCCAACGCGTTCCTGAAGATGGAAGGCAACGACATCGTGATCGGCGCGCCGGG
CAAAGCGACGTTCCATGCGGCCCAGCACACGCTGACTGGCCCGCGATCCGCGAACGTCCAGTTGCCGTCG
ATGAACAAGCCCGCATGTGTCGAATGCATGCGGGATCTCGCGCATCGCCACGAAGCGATCGCCACGCGCG
GGTGA