SecReT6
Effector Protein ID: 206563705
-
SecReT6 ID940
T6SS type
Gene symbol-
Locus tagBCAM1857
StrainBurkholderia cenocepacia J2315
Repliconchromosome II [GenBank: NC_011001] [Browse all T6SS(s) in this replicon]
Location [Strand]2076087..2076566 [-]
Producthypothetical protein
Effector typeProtein
Homologous effectorTecA
Description
UniProt IDB4EMB9
KEGG IDbcj:BCAM1857
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 159 a.a.     [Download]
>gi|206563705|ref|YP_002234468.1| hypothetical protein BCAM1857 [Burkholderia cenocepacia J2315]
MQLTQLGGHVAQSGIAERQKHAQALMFGMANIDEYVSRGVCYDAAAYVRYLLRADALIAPDALLDTAGQS
WRTRFNFETGDQWDGRASIPAGTAVGFARGGNVFHAAIAVGGTRIRAINGGLLGAGWMNPVDLARALQPD
PAGGFTYDRTTIRVHLSRL
-
Nucleotide Sequence: 480 bp     [Download]
>gi|206561868|ref|NC_011001.1|:c2076566-2076087 Burkholderia cenocepacia J2315 chromosome 2, complete sequence
GTGCAGCTGACCCAGTTAGGCGGGCATGTCGCCCAATCCGGCATCGCCGAACGGCAAAAACACGCGCAGG
CGCTGATGTTCGGGATGGCGAACATCGACGAATACGTATCCCGCGGCGTCTGCTACGACGCCGCGGCCTA
TGTCCGCTATCTGCTGCGTGCAGACGCGCTGATCGCGCCCGATGCGCTGCTCGATACGGCCGGTCAATCG
TGGAGGACGCGGTTCAACTTCGAAACCGGCGATCAGTGGGACGGGCGCGCGAGCATTCCGGCGGGCACCG
CGGTCGGCTTCGCGCGCGGCGGCAATGTCTTTCATGCGGCGATTGCGGTCGGCGGCACCCGGATTCGCGC
GATCAACGGCGGGCTGCTGGGCGCCGGATGGATGAATCCGGTCGACCTTGCACGGGCGCTGCAGCCGGAT
CCGGCCGGCGGCTTTACGTACGATCGCACGACCATTCGCGTCCATCTGTCGCGCCTGTAG

Reference
(1) Daniel F Aubert, Hao Xu, Jieling Yang, Xuyan Shi, Wenqing Gao, Lin Li, Fabiana Bisaro, She Chen, Miguel A Valvano, Feng Shao (2016). A Burkholderia Type VI Effector Deamidates Rho GTPases to Activate the Pyrin Inflammasome and Trigger Inflammation. Cell Host Microbe. 19(5):664-74. [PudMed:27133449] experimental
 
experimental experimental literature