SecReT6
Effector Protein ID: 206577151
-
SecReT6 ID306
T6SS typeA2
Gene symbol-
Locus tagKPK_3064
StrainKlebsiella pneumoniae 342
Repliconchromosome [GenBank: NC_011283] [Browse all T6SS(s) in this replicon]
Location [Strand]3119106..3119597 [-]
Producttype VI secretion system effector
Effector typeProtein
Homologous effectorEC042_4529
DescriptionHcp protein
UniProt IDB5XRR6, B5XRR6
KEGG IDkpe:KPK_3064
PDB IDNA
Domain hit(s) vs Pfam DUF796 [PF05638], Evalue: 2.10E-37, Aligned region: 6..147
Protein Sequence: 163 a.a.     [Download]
>gi|206577151|ref|YP_002238890.1| unnamed protein product [Klebsiella pneumoniae 342]
MAIPVYLWLKDDGGADIKGSVDVQDREGSIEVVAQEHNLYIPTDNNTGKLTGTRIHTPFLFTKEIDSSSP
YLYKAVTTGQTLKSAEFKWYRINDAGQEVEYFNTKLENVKVVKVNPLMHDIKNPAYEKHNHLEQIELRYE
KITWTYKDGNIIHSDSWNERATA
-
Nucleotide Sequence: 492 bp     [Download]
>gi|206575712|ref|NC_011283.1|:c3119597-3119106 Klebsiella pneumoniae 342 chromosome, complete genome
ATGGCAATTCCTGTTTATCTTTGGCTGAAAGACGACGGCGGGGCGGACATTAAAGGGTCTGTCGACGTTC
AGGATCGTGAAGGCAGTATCGAAGTGGTGGCTCAGGAGCACAACCTGTACATCCCGACCGATAACAACAC
CGGCAAACTGACCGGCACGCGTATCCATACGCCGTTCCTGTTCACCAAGGAGATCGACTCCTCCAGCCCG
TACCTGTACAAGGCAGTGACCACCGGCCAGACCCTGAAATCCGCTGAGTTCAAGTGGTACAGAATCAACG
ATGCCGGCCAGGAAGTGGAGTATTTCAATACCAAACTTGAGAACGTCAAGGTGGTGAAAGTGAATCCCCT
GATGCACGACATCAAAAACCCTGCCTACGAGAAGCACAACCATCTGGAACAGATTGAGCTGCGCTACGAG
AAGATCACCTGGACCTATAAAGACGGCAACATCATTCACTCCGATAGCTGGAACGAACGCGCCACAGCGT
AA