SecReT6
Effector Protein ID: 209694748
hcp
SecReT6 ID308
T6SS typeA5
Gene symbolhcp
Locus tagVSAL_I1202
StrainAliivibrio salmonicida LFI1238
Repliconchromosome I [GenBank: NC_011312] [Browse all T6SS(s) in this replicon]
Location [Strand]1311319..1311840 [+]
Productsecreted protein Hcp-1
Effector typeProtein
Homologous effectorVEPGS_0021
DescriptionHcp protein
UniProt IDB6EJM3
KEGG IDvsa:VSAL_I1202
PDB IDNA
Domain hit(s) vs Pfam DUF796 [PF05638], Evalue: 5.60E-35, Aligned region: 6..156
Protein Sequence: 173 a.a.     [Download]
>gi|209694748|ref|YP_002262676.1| secreted protein Hcp-1 [Aliivibrio salmonicida LFI1238]
MPTPAYMSIKGEVQGDITKDAYSADSIGNTWQEAHIDEFLVQELDHVLTVPRDPQSGQPTGQRVHRPVIV
TKQQDRCSPLLFNSLVSGEKLPECSINFYRTSISGKQEHYYTIKLIDALLVDMQTRMAHCQDAATSDRVT
EEVLKFTYRAIEVTHETCGTAGNDDWRAPREAG
-
Nucleotide Sequence: 522 bp     [Download]
>gi|209693634|ref|NC_011312.1|:1311319-1311840 Aliivibrio salmonicida LFI1238 chromosome chromosome 1, complete sequence
ATGCCAACTCCAGCGTATATGTCAATAAAAGGCGAAGTTCAGGGTGACATCACTAAAGATGCGTATTCAG
CAGATTCAATAGGGAATACGTGGCAAGAAGCACACATTGATGAGTTTCTTGTTCAAGAACTTGATCATGT
ATTAACGGTTCCACGTGATCCTCAAAGTGGCCAGCCAACAGGTCAACGAGTTCACCGTCCTGTGATTGTA
ACTAAACAACAAGACCGCTGTTCTCCATTGTTGTTTAACTCATTAGTTTCAGGTGAAAAATTACCAGAGT
GCAGTATCAACTTCTACCGTACGTCTATTTCTGGTAAGCAAGAGCACTATTACACAATCAAATTGATTGA
TGCACTGCTTGTAGATATGCAAACTCGCATGGCTCATTGTCAAGATGCTGCAACGTCAGATCGTGTAACA
GAAGAAGTGCTTAAGTTTACTTACCGTGCAATTGAAGTGACTCACGAAACGTGTGGCACGGCAGGTAATG
ATGATTGGCGCGCACCACGCGAAGCGGGTTAA