SecReT6
Effector Protein ID: 215481876
-
SecReT6 ID312
T6SS typeA4b
Gene symbol-
Locus tagABBFA_000117
StrainAcinetobacter baumannii AB307-0294
Repliconchromosome [GenBank: NC_011595] [Browse all T6SS(s) in this replicon]
Location [Strand]131981..133729 [+]
ProductLysM domain protein
Effector typeProtein
Homologous effectorABBFA_000117
DescriptionLysM,is a predicted peptidoglycan hydrolase, within the cytoplasm of E. coli cells did not result in any cell toxicity but toxic in periplasm.
UniProt IDNA
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam LysM [PF01476], Evalue: 6.4e-11, Aligned region: 113-156
Protein Sequence: 582 a.a.     [Download]
>gi|215481876|ref|YP_002324058.1| LysM domain protein [Acinetobacter baumannii AB307-0294]
MNKKGLIQFRFVELFTGNNIPNLYHVIKNEKGTTIASGMTNSNGLTVMISRDVGDTLYVYLKNIITGDLK
EKVRHTVIYKKEIVRVTSSKILLDNIILAKSTNKPGNYRYLTHKVKKGENLSLISHRFNCKISEIVHLNK
LKNPDHIDVGQIIKIPYKGGSSDSKKSPDNKQSKHENNKSSSTQKVNSHENNNKNTSDKPQKRIESKDIT
DEYTKESGKPMKVATNATSPCICKQYNLAWGSKVSCEFRKRVIKIAQNLWPNDSENMASQLMAVMHLESA
GTFSPKIGTFISKKLTDDAKGGYVGLIQFGKFASIDLKVKRSDLAKMSAVQQLDYVEKYYKLNSAHTKIK
NLTGLYLWVNYPKNVKENRLEDEDIVYAAPKDAEVTSKKFLESPYHQNPSFMKENEEYKRDGKKVIRQGF
KNGSTKVWEVEQEIKKHLTEGIKSQNLEKNYNCAYINHTEIKNTQKINLEKFAEILRKRAKEKSQHQCAK
YVRIALEAGGADTSGHPVAASDWGPTLKKIGYKEIPEEFNKPQLGDIYIITKTDKHQYGHIAGYDGSQWI
SDFKQKGHRIYSDHVNYRYFRM
-
Nucleotide Sequence: 1749 bp     [Download]
>gi|215481761|ref|NC_011595.1|:131981-133729 Acinetobacter baumannii AB307-0294, complete genome
ATGAATAAGAAAGGTTTAATTCAGTTTAGGTTTGTTGAATTATTTACTGGTAATAATATACCTAATTTAT
ATCATGTTATTAAGAATGAAAAGGGCACAACTATTGCTTCTGGAATGACAAATAGTAATGGCTTAACAGT
AATGATAAGTAGAGATGTAGGCGATACTCTTTATGTATATTTAAAAAATATTATAACAGGTGATTTGAAA
GAAAAAGTTAGACACACTGTTATTTATAAAAAGGAGATAGTAAGAGTAACATCATCAAAAATACTATTAG
ATAATATTATCTTAGCAAAATCAACGAATAAACCTGGTAATTATAGATATTTAACGCATAAAGTAAAAAA
AGGAGAAAACTTATCTTTAATTTCTCATCGATTTAATTGTAAAATTAGTGAAATTGTACATTTGAATAAA
TTAAAAAATCCTGATCATATAGATGTCGGACAAATTATTAAAATTCCATACAAAGGTGGATCAAGTGATT
CTAAGAAAAGTCCTGATAACAAACAATCTAAGCATGAAAATAATAAATCATCTTCTACTCAGAAAGTAAA
TTCACATGAAAATAATAATAAAAATACTTCAGATAAACCTCAAAAAAGAATAGAGTCAAAAGATATAACT
GATGAATATACAAAAGAGTCAGGAAAACCAATGAAAGTTGCTACTAATGCAACTTCACCATGTATTTGTA
AACAATATAATTTGGCTTGGGGATCTAAAGTTAGTTGCGAATTTAGGAAAAGAGTTATAAAAATAGCACA
AAATTTGTGGCCTAATGATTCAGAGAATATGGCAAGCCAATTAATGGCTGTTATGCATTTAGAGTCTGCC
GGAACTTTTAGTCCAAAAATTGGAACTTTTATCAGCAAAAAATTAACAGATGATGCTAAAGGTGGTTATG
TTGGTCTTATCCAATTCGGAAAATTTGCTTCAATTGATTTAAAAGTTAAAAGATCTGATTTAGCGAAAAT
GTCAGCTGTACAACAATTAGATTATGTAGAAAAATACTATAAATTAAACTCTGCTCATACAAAGATTAAA
AATCTAACTGGATTATATTTATGGGTTAATTATCCTAAAAATGTCAAAGAAAACCGATTAGAAGATGAAG
ATATTGTATATGCGGCACCCAAAGACGCAGAAGTAACTTCTAAAAAATTTTTAGAAAGCCCATATCACCA
AAATCCTAGTTTTATGAAAGAGAATGAGGAATATAAACGGGATGGTAAAAAAGTTATTAGACAAGGATTT
AAAAATGGTTCAACTAAAGTTTGGGAGGTTGAACAAGAAATTAAAAAACATTTAACCGAAGGTATAAAAA
GTCAAAATTTAGAGAAAAATTATAATTGTGCATACATAAATCATACTGAGATAAAAAATACTCAGAAAAT
TAATTTGGAAAAATTTGCTGAAATTTTGAGAAAGAGAGCTAAAGAAAAAAGTCAACATCAATGTGCAAAG
TATGTAAGAATTGCATTAGAGGCAGGAGGAGCCGACACTTCAGGACATCCTGTCGCAGCATCAGATTGGG
GGCCAACTCTCAAAAAAATAGGTTATAAAGAAATACCTGAAGAGTTTAATAAACCTCAATTAGGTGATAT
TTATATCATCACCAAAACTGATAAGCATCAATATGGCCATATTGCAGGCTATGATGGTAGCCAATGGATT
TCTGATTTTAAACAAAAAGGTCATAGAATTTATAGCGATCATGTTAACTACAGATATTTTAGAATGTAA

Reference
(1) Fitzsimons TC, Lewis JM, Wright A, Kleifeld O, Schittenhelm RB, Powell D, Harper M#, Boyce JD (2018). Identification of Novel Acinetobacter baumannii Type VI Secretion System Antibacterial Effector and Immunity Pairs. Infect Immun. 86(8). pii: e00297-18. [PudMed:29735524] experimental
 
experimental experimental literature