SecReT6
Effector Protein ID: 215483914
SecReT6 ID312
T6SS typeA4b
Gene symbol-
Locus tagABBFA_002237
StrainAcinetobacter baumannii AB307-0294
Repliconchromosome [GenBank: NC_011595] [Browse all T6SS(s) in this replicon]
Location [Strand]2384073..2384576 [-]
Producttype VI secretion system effector, Hcp1 family protein
Effector typeProtein
Homologous effectorA1S_1296
DescriptionHcp protein
UniProt IDB7H4J1
KEGG IDabb:ABBFA_002237
PDB IDNA
Domain hit(s) vs Pfam DUF796 [PF05638], Evalue: 4.30E-43, Aligned region: 5..140
Protein Sequence: 167 a.a.     [Download]
>gi|215483914|ref|YP_002326139.1| type VI secretion system effector, Hcp1 family protein [Acinetobacter baumannii AB307-0294]
MKDIYVEFRGKYKVDGESRDSEHKGWLEVNSWSHNIRQPKSATSSSVGGHTAERVEHSDMVFVKDLDATS
PKLWEACSAGYTFDEVQIDFYRANGDKRIKYLQIKLKHVLVSSVTPTVNEEGVPTEAFGLKYAAVEWTYN
QQDINGTAKGAVTKKWSLSNNTASYAA
-
Nucleotide Sequence: 504 bp     [Download]
>gi|215481761|ref|NC_011595.1|:c2384576-2384073 Acinetobacter baumannii AB307-0294, complete genome
ATGAAAGATATATACGTTGAGTTTCGCGGTAAATATAAAGTTGATGGAGAGTCTCGTGATTCTGAGCACA
AAGGTTGGTTAGAAGTTAACTCTTGGTCTCATAACATCCGTCAACCTAAATCTGCTACTTCAAGTAGTGT
GGGCGGCCACACTGCTGAACGTGTTGAACATTCTGACATGGTTTTCGTGAAAGACTTAGACGCAACTAGC
CCTAAATTATGGGAAGCTTGTTCAGCTGGTTATACATTTGATGAAGTACAAATCGACTTCTATCGCGCAA
ATGGCGATAAACGTATCAAGTACTTACAAATCAAATTGAAGCACGTTTTAGTTTCTAGTGTGACTCCAAC
TGTTAACGAAGAAGGCGTTCCTACAGAAGCATTCGGTTTGAAATATGCTGCTGTTGAGTGGACTTATAAC
CAACAAGATATTAACGGTACTGCTAAAGGTGCTGTTACTAAGAAATGGTCACTTTCTAATAATACAGCTT
CTTACGCAGCGTAA