SecReT6
Effector Protein ID: 215483952
-
SecReT6 ID312
T6SS typeA4b
Gene symbol-
Locus tagABBFA_002275
StrainAcinetobacter baumannii AB307-0294
Repliconchromosome [GenBank: NC_011595] [Browse all T6SS(s) in this replicon]
Location [Strand]2420733..2425604 [-]
Productcore protein
Effector typeProtein
Homologous effectorABBFA_002275
DescriptionRhs2 contained an AHH (alanine-histidine-histidine) motif within the C-terminal region that is characteristic of AHH superfamily nucleases.
UniProt IDNA
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam RHS_repeat [PF05593], Evalue: 1.4e-05, Aligned region: 738-755
RHS_repeat [PF05593], Evalue: 5.0e-07, Aligned region: 780-814
RHS_repeat [PF05593], Evalue: 6.6e-06, Aligned region: 860-894
RHS_repeat [PF05593], Evalue: 3.7e-05, Aligned region: 902-940
RHS [PF03527], Evalue: 9.8e-16, Aligned region: 1385-1422
AHH [PF14412], Evalue: 1.5e-10, Aligned region: 1501-1608
Protein Sequence: 1623 a.a.     [Download]
>gi|215483952|ref|YP_002326177.1| core protein [Acinetobacter baumannii AB307-0294]
MSQNSVVAPLNTFSPKDLTAKKAEVDKWFREYTNGVVTVDRLETICRSVPVLGSAFAIGDIIIDIISMIN
KGGLDKVEIFDWLNLGIDVIGLVPMGPVGPSVRSAARPALFYVKNESEKIIKAQAKKLGKKTLTSQEVKK
ALSTGFKDSASVFLTTIIAENVAGTLENFAKKGQSLLNQILKEVGNWIVLLTKTIDDGFKKLVSGSLNGL
PNLKRAGQQSLGVIKGIFELDGTRIVNNAKYATENVAKTVGKGYVNLANLAVSDEARAKVLALGAKIRSI
GQVAQAKVNGLSDPNTLWTIGWLFSIMGMVAAKHRQKRAQIKAKETTKANASHPSTATDKSNKQAHAENN
ANQCKNCMGGTGGSITFAMGTEFFTHVDAQLGGIIQDSISRTYVSNLYQMDDAIFGARWVTPFTTKISRK
FKYTSKKKDHKDYLNGLEYICLDGRAIDLPDLKKGQSIYDPIEQYTYTVLSDQLHLIAYGEDEKRYYEKY
GEDYRLSYIERKNGFKVALRYDHVSTDNKTILSDILFKQDDNLLAHLALQLTPQGLVSDIWTIKNGQLDR
VLASYDYDQQGDLVQATNEFAASYYYQYTHHLITRYTDLTHRGMNLKWDGILPTSKAIEEWADNASRASK
LEWDKNIRKTTVLDVEGNSTEHYYDIDGYTYRIVYPDNFEEWFFRDDAKNITLHIAKDGSKTSYTYDERG
NVLTTTQDDGATSYFEYDEKNQLTGMVDAEQGRWFKQYDGSGNLIKEIDPLKHETAYVYNAMGLVTSITD
AKGGSKSLKYDDQGNLISYTDCSGKETKWQYDERGRVISIENALNQKVEYFYTELTLENREPIIKGLPLN
AFGQLEKIKHADGTEEHFIHDAEGRLLAHVDPKQNITRYEYDEAGLILSRTDALNHKLKYKWDRLGRLTR
LINENGASYQFFYDVASRLVKEIDFDGKETVYHYDEKSGQLATSIEVASAYGQDLKDRAAPKDRIQQFIF
DSMGRLEQRTAGYGHYGLELEEKQTEEFAYDYMGRIIQAKNAQSNLQWFYDAAGNLVQEHQQDYKINKTA
VWKHQYDEINDRIKTTRPDGQVIDWLTYGSGHVQSLIVNGQDFVSFERDDLHREIARHYANGVSQEQQYD
LAGRLKSQMMLSEHENGYQNQYKRHNNALEQTSQLVQRLYQYDKTGELTAIRDTRRGNIAYKYDPVGRLL
EASSKLGKETFSFDPASNILDSYHSQKVQSHSQKLDETSYGYNRLVNNVVKEYLDQQYQYDAYGQLIRQK
TSQGDLNLEWDVYGRMVKSRNSQYTAEYRYDALGRRIQKWSKHHHTGQEQNIIYGWDGDTLAYESTEELT
KHYIYEKDSFVPMLQAVYLSPIELHQTPDWSDRPYNIHRDPLWKTEKEGKEFDDVWFYHCDHLGTPQEMT
DHTGAIIWKAEYKAWGECKAEEAKSNFFENSEIISNNIRFQGQYFDEETGLHYNRYRYYSPYVGRFVSKD
PIGLLGGNNVYVYAKNPITWIDSKGLCSTTLNRNLGGVKGDHLQAHHIIPEEIWAKRKDFLDDIGIGGNR
DKAENGVLMPDSEAKAKQMKRQLYHCGSHPIYSAGINQKLGQIQREFESKKITASQARDKVANLQSSMRL
VLITPGTKPIRLS
-
Nucleotide Sequence: 4872 bp     [Download]
>gi|215481761|ref|NC_011595.1|:c2425604-2420733 Acinetobacter baumannii AB307-0294, complete genome
ATGTCACAAAATTCAGTCGTTGCTCCTTTAAATACTTTTAGTCCCAAAGATTTAACTGCAAAAAAAGCAG
AAGTTGATAAATGGTTTAGGGAATATACAAATGGTGTGGTTACAGTTGACCGACTTGAGACAATCTGTAG
AAGTGTCCCTGTTTTAGGTAGTGCCTTTGCTATTGGCGATATTATTATTGATATTATAAGTATGATCAAC
AAAGGTGGTCTTGATAAAGTTGAGATCTTTGATTGGTTAAATTTGGGAATTGATGTCATTGGATTGGTGC
CAATGGGACCAGTTGGTCCTTCGGTACGTAGTGCAGCACGGCCAGCATTATTTTATGTAAAGAATGAATC
AGAAAAAATTATCAAAGCACAAGCAAAGAAATTAGGCAAAAAAACATTAACTTCTCAAGAAGTAAAAAAA
GCTTTAAGTACAGGGTTTAAAGACAGCGCAAGTGTATTTTTAACGACCATTATCGCTGAAAATGTAGCGG
GTACTTTAGAAAACTTTGCTAAGAAGGGACAGAGTTTACTTAATCAAATACTAAAAGAAGTTGGTAACTG
GATTGTCTTATTAACAAAAACTATTGATGATGGCTTTAAGAAATTAGTAAGTGGCTCTTTAAATGGACTT
CCAAACCTTAAGCGAGCGGGCCAACAGTCTTTAGGAGTTATAAAAGGAATATTTGAACTTGATGGAACCC
GTATAGTAAACAATGCCAAATATGCTACTGAAAACGTTGCAAAAACTGTGGGTAAAGGGTATGTCAATTT
AGCCAATTTAGCAGTCTCCGATGAAGCACGAGCTAAAGTTTTAGCTTTAGGCGCAAAAATAAGGTCTATA
GGTCAAGTTGCTCAAGCAAAAGTAAACGGTTTAAGTGACCCTAATACTTTATGGACTATTGGTTGGCTAT
TTAGCATTATGGGAATGGTTGCTGCAAAACATCGGCAAAAGAGAGCGCAGATTAAGGCCAAAGAAACAAC
AAAGGCCAATGCAAGTCATCCATCAACTGCGACTGACAAATCAAATAAACAAGCTCATGCCGAGAACAAT
GCCAATCAGTGTAAAAACTGTATGGGTGGAACTGGTGGTTCAATTACCTTTGCAATGGGTACCGAGTTCT
TTACTCATGTTGATGCACAACTTGGCGGAATAATTCAGGACAGCATTAGCCGTACCTATGTTTCAAACCT
TTACCAGATGGATGATGCTATATTTGGCGCACGTTGGGTTACTCCATTTACTACAAAAATTTCTCGTAAA
TTTAAATATACTTCAAAGAAAAAAGACCATAAAGACTATTTAAATGGGCTTGAATACATCTGTTTAGATG
GTCGGGCAATTGATTTGCCAGACCTAAAGAAGGGACAAAGTATTTATGATCCGATTGAGCAATACACTTA
TACAGTTTTATCAGATCAGCTGCATTTAATTGCCTACGGTGAAGACGAGAAACGCTATTATGAAAAATAC
GGTGAGGACTATCGTCTATCCTATATAGAACGTAAAAATGGTTTCAAAGTCGCTTTACGTTATGACCATG
TTTCTACGGATAATAAAACGATTTTATCGGACATTTTATTTAAACAGGACGATAACTTGCTGGCTCATTT
AGCTTTGCAATTAACTCCCCAAGGTTTGGTTTCCGATATTTGGACCATCAAAAATGGCCAATTAGATCGT
GTTTTGGCAAGTTATGATTATGATCAACAAGGTGATTTGGTTCAGGCAACAAATGAGTTTGCAGCTTCTT
ATTATTATCAATATACCCATCACTTAATTACACGTTATACAGATCTTACACATCGTGGGATGAACCTAAA
ATGGGATGGTATTTTACCTACTTCAAAAGCCATTGAAGAATGGGCCGACAATGCTAGTCGTGCTTCAAAG
CTGGAGTGGGATAAAAATATCCGAAAAACGACAGTGTTAGACGTTGAGGGGAATAGCACTGAACATTACT
ACGATATTGATGGCTATACTTACCGTATTGTTTATCCTGATAATTTTGAAGAGTGGTTCTTTCGAGATGA
TGCGAAAAATATAACACTCCATATTGCTAAAGACGGTTCGAAAACTTCTTACACTTATGATGAGCGTGGT
AATGTCTTGACTACAACTCAAGATGATGGTGCGACAAGTTATTTTGAATATGATGAAAAAAATCAACTCA
CTGGTATGGTTGATGCCGAACAGGGACGTTGGTTTAAGCAGTATGATGGTTCTGGAAACCTGATCAAAGA
AATTGATCCACTTAAGCATGAAACTGCTTATGTTTACAATGCGATGGGCCTAGTCACTTCCATTACAGAT
GCTAAAGGTGGAAGTAAGTCACTTAAATATGATGATCAAGGGAATTTAATTAGTTATACAGATTGCTCAG
GTAAAGAGACCAAGTGGCAATATGATGAGCGTGGTCGTGTAATAAGCATTGAAAATGCATTAAACCAAAA
AGTTGAGTATTTTTATACTGAACTTACCTTAGAAAATCGGGAACCAATTATAAAGGGTTTACCTCTGAAT
GCTTTTGGTCAACTTGAAAAGATTAAACATGCTGATGGCACAGAAGAACACTTCATTCATGATGCTGAAG
GGCGTTTACTGGCGCATGTAGATCCTAAACAGAACATCACTCGCTATGAATATGATGAGGCAGGTTTAAT
TCTGTCTCGTACAGATGCTCTAAACCATAAATTAAAATATAAATGGGATCGATTGGGACGTCTCACCCGA
CTCATTAATGAAAATGGTGCCAGTTACCAATTCTTCTATGATGTCGCAAGCCGACTCGTTAAAGAAATTG
ACTTTGATGGTAAGGAAACGGTTTACCATTACGATGAAAAGTCGGGCCAACTTGCAACCAGTATTGAAGT
TGCATCTGCTTATGGACAAGACCTCAAAGACCGAGCTGCACCGAAAGACCGAATTCAACAATTTATTTTT
GACAGTATGGGGCGTTTAGAACAGCGTACAGCGGGTTATGGTCATTATGGTTTAGAACTTGAAGAAAAAC
AGACTGAAGAATTTGCCTATGATTATATGGGGCGAATCATTCAAGCTAAAAATGCTCAAAGTAATTTACA
ATGGTTTTATGATGCGGCTGGCAATTTAGTACAGGAACACCAGCAAGATTATAAAATCAATAAAACAGCG
GTGTGGAAACACCAATATGACGAAATTAATGATCGAATCAAAACAACTCGTCCAGACGGGCAGGTTATTG
ACTGGTTGACCTATGGTAGCGGTCATGTACAAAGTTTAATAGTGAATGGTCAAGACTTTGTTAGCTTTGA
GCGTGATGATTTACACCGTGAAATCGCACGTCACTATGCCAACGGAGTGAGTCAAGAACAGCAATATGAC
TTAGCAGGTCGTTTGAAAAGCCAAATGATGTTAAGTGAACATGAAAATGGCTATCAAAACCAATATAAGC
GCCACAACAATGCATTAGAGCAGACCAGTCAACTGGTACAGCGTCTTTATCAATATGACAAAACAGGTGA
GCTAACGGCAATTCGAGATACACGCCGTGGCAATATTGCCTATAAATACGATCCTGTAGGGCGTTTACTT
GAAGCGAGCAGTAAGTTAGGTAAAGAAACATTTAGTTTTGACCCTGCGAGTAACATTCTAGATTCATACC
ATAGTCAGAAAGTTCAAAGCCATTCACAAAAGCTAGACGAAACGAGTTATGGTTATAATCGTTTGGTTAA
TAATGTAGTTAAAGAATATTTAGACCAACAATACCAATATGATGCTTATGGACAACTCATACGACAAAAA
ACGAGCCAAGGTGATTTAAACCTTGAGTGGGATGTCTATGGCCGCATGGTAAAGAGCCGTAATAGTCAAT
ACACGGCAGAATATCGTTATGATGCTTTAGGCCGCCGTATTCAAAAGTGGAGTAAGCATCACCATACTGG
TCAAGAGCAGAACATCATTTATGGATGGGATGGCGATACGCTTGCTTATGAGTCGACAGAGGAACTGACT
AAGCATTACATCTATGAAAAGGACAGTTTCGTGCCAATGCTACAGGCTGTTTATTTAAGTCCAATAGAAT
TACACCAAACTCCAGATTGGTCAGATAGACCTTATAATATACACCGAGACCCGCTTTGGAAAACTGAAAA
AGAGGGTAAAGAATTTGATGATGTATGGTTCTATCACTGTGACCACTTAGGTACGCCGCAAGAAATGACT
GACCATACAGGTGCAATTATTTGGAAAGCTGAATATAAAGCTTGGGGCGAGTGTAAAGCAGAGGAAGCCA
AGTCGAATTTCTTCGAAAATAGTGAAATTATTTCAAATAATATCCGTTTTCAAGGACAGTATTTTGATGA
AGAAACAGGGTTACATTACAATCGCTATCGTTATTATTCACCGTATGTAGGTAGGTTTGTCAGCAAAGAC
CCGATTGGATTGTTGGGTGGTAATAATGTTTATGTATATGCTAAGAACCCGATTACATGGATAGATAGTA
AGGGATTATGTAGTACCACCTTAAACAGAAATTTAGGAGGAGTAAAAGGTGATCATTTACAAGCTCATCA
TATTATTCCTGAAGAAATTTGGGCCAAGCGCAAAGATTTTTTAGATGATATTGGTATTGGCGGAAATAGA
GATAAAGCAGAAAATGGCGTTTTAATGCCTGACAGTGAAGCTAAGGCAAAACAAATGAAGCGCCAATTAT
ATCATTGTGGGTCACATCCAATTTATTCTGCAGGTATTAATCAAAAGTTAGGACAAATACAGAGAGAATT
TGAAAGTAAGAAAATAACCGCTTCTCAAGCTAGAGATAAAGTGGCAAATTTACAGTCAAGTATGAGACTT
GTTTTAATAACACCTGGTACAAAACCAATCAGATTAAGTTAG

Reference
(1) Fitzsimons TC, Lewis JM, Wright A, Kleifeld O, Schittenhelm RB, Powell D, Harper M#, Boyce JD (2018). Identification of Novel Acinetobacter baumannii Type VI Secretion System Antibacterial Effector and Immunity Pairs. Infect Immun. 86(8). pii: e00297-18. [PudMed:29735524] experimental
 
experimental experimental literature