SecReT6
Effector Protein ID: 215484143
-
SecReT6 ID312
T6SS typeA4b
Gene symbol-
Locus tagABBFA_002468
StrainAcinetobacter baumannii AB307-0294
Repliconchromosome [GenBank: NC_011595] [Browse all T6SS(s) in this replicon]
Location [Strand]2627614..2632386 [-]
Productprotein rhsD precursor
Effector typeProtein
Homologous effectorABBFA_002468
DescriptionRhs1 shares amino acid identity with several previously characterized T6SS Rhs family nuclease effectors.
UniProt IDNA
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam RHS_repeat [PF05593], Evalue: 1.1e-06, Aligned region: 521-557
RHS_repeat [PF05593], Evalue: 5.5e-06, Aligned region: 651-688
RHS_repeat [PF05593], Evalue: 0.00012, Aligned region: 672-709
RHS_repeat [PF05593], Evalue: 9.2e-05, Aligned region: 735-772
RHS [PF03527], Evalue: 2.4e-11, Aligned region: 1288-1323
Protein Sequence: 1590 a.a.     [Download]
>gi|215484143|ref|YP_002326368.1| protein rhsD precursor [Acinetobacter baumannii AB307-0294]
MAKENTQQKEIKRQPAVELAVFNLNSVTDVADLQMIASQVQLYLQVCGNTTLEQIKSKANITTVANIFAL
TGSVLDLMLYATDKKTGDAAVQRGALLAANLIGLFSEPNNEAHARMALRPMFGLMAECLYRENGKIKETD
IKRLGLHLNAMIAGDLENFLKETQAKLSSLLISATTLGVTILQSMATPATGINAGITTAAGASAEKRDPK
LKFTNWAVPLIDLLGKPSQANLTPKIQPNITSRLQQEATQAIAALSQTLQQQANAGQKYTLAWLLQETLK
AIQALENKGNASVPINQTGEYERHTKGDTLEFVSLQADALNAPPCEGADSQSGKSISYSIGAERVQHADF
YLPKIGFSFIRQYNSQMDEFDQSMVGARWMMPFSNMIQQNAQGYLFIDSKGRKHQLPVSIIFETYEVPYE
GWIIKPLKNGELILDFGGEWRSHFQSFDGGKNYYLVKKMNETSQEEILLEYLLLDHIAYLKVINFKLKQA
EYELKFAFNEQVKIIAVFLDDKAEPLARYEYDTQGNLIKAIDQNGHTRTYEYNQFHQLTRYTDRTGRGQN
IRYESTEAKAKAIEEWADDGSFHTKLKWHPRLRQVAVYDAYDVPTYYYFDLDGFTYRTRLADGRESWYSR
DGKKRITRQIDFDGRETQQEYNDQDQLVKIVQPNGGIIRFAYNKQGNLVEIKDPEGSIWKREYDENRNVS
KEINPLGHITQYKYNNDNQLVEVIDAKGGVKKIQYNELGQMISYTDCSGKSSTWEYDEDGALTAEQTANN
KVVQYFYSTKGRDKGQLQSIIYPDGLKEYFEHDEEGRLLKHTDTKGLVTEYKYNQVGLLEQRIDANRHSV
AYQWDKQGRIQKLINQNQAEYLFGYNPYGYLIREQAFDGEEKHYSYNENGRLFQIRRPNILTQFDYYADG
QIASKSFTHLHTGQKQTEQFDYNLNSQLSRASNEVSQIDLYRNALGQLVREHQHYKIPELKPLTAVLHYE
YDELGNLIKTIRPDGHTLNHLVYGSGHIYAIGLNNQEVVSFQRDDLHRETTRLLANGLMQTKQYNDVGLL
SSQFIQPEQETQDYLQYQAHRKYHYDKNYLLSQVEDSRLGKLNYQYDPIGRLIAAQSLHKTESFNFDPAG
NLIDSESVLSPAQIKNNLIKSYKGKHYQYDVQGNVTEIIQAGKNLKLTWDNQNRLIRSDNNGLVTEYGYD
VFGRRLYKKTAKELTLFGWDGDLMIWESFKSAQTNYTKHYIYEPDSFVPLLQAGYKDFIQLIETPDYQEY
QTKPYSIYKDPVWNRNLGKERTALEQFTFYHCDQVGTPQTMTNIRGECVWEILQDTWGAVSQIKALNQDN
PFEQNNLRFQGQYYDRETELHYNRYRYYEPHSARYVSKDPIGLEGGMNTSSYVSDPNQWIDPKGLNSFNY
GEMFGIPASAQSGLAYQGQRNYECYAETGELCKIKVPPLFDYVACSGGGLGIGVGFVKNQWTGEYYISGS
KDSLLIPVAKSVAQNKQFSAKDLAGASCVGGNIHNIPSYTKTTMTMGEITNEFVSGASVTVGGGAYGAVA
NVVVPLVSKSSPVKGTWASELGVGTPGFNVGVSGTVSVDTILDAVKPSKK
-
Nucleotide Sequence: 4773 bp     [Download]
>gi|215481761|ref|NC_011595.1|:c2632386-2627614 Acinetobacter baumannii AB307-0294, complete genome
ATGGCTAAAGAGAATACACAACAGAAAGAAATTAAAAGACAACCTGCTGTTGAACTTGCTGTTTTTAACT
TAAATAGCGTGACGGATGTAGCGGACTTGCAAATGATCGCAAGTCAGGTTCAGCTGTATTTACAAGTGTG
TGGAAACACGACATTAGAACAAATAAAAAGTAAGGCCAATATAACCACGGTTGCTAATATTTTTGCATTG
ACGGGTAGTGTACTAGATCTAATGCTCTATGCTACAGATAAAAAAACTGGTGATGCTGCTGTACAACGTG
GGGCATTACTTGCGGCAAATTTAATTGGTTTATTTTCAGAACCGAATAATGAAGCACATGCACGCATGGC
TTTACGTCCGATGTTTGGCTTAATGGCAGAGTGCTTATATCGAGAAAATGGAAAAATTAAAGAAACGGAT
ATTAAGCGTTTAGGTTTACATCTCAATGCGATGATCGCTGGAGATCTAGAGAACTTCTTAAAAGAGACTC
AAGCGAAGTTAAGCAGTTTACTTATTAGCGCTACAACATTGGGTGTAACCATTCTACAAAGCATGGCGAC
CCCAGCAACAGGTATAAATGCAGGAATAACCACTGCGGCAGGTGCAAGTGCAGAAAAACGAGATCCGAAA
CTCAAATTTACCAACTGGGCTGTTCCACTCATTGATTTATTAGGGAAGCCGAGCCAAGCAAATTTAACCC
CTAAAATACAACCAAATATAACAAGTCGTTTGCAACAAGAAGCAACTCAAGCTATTGCGGCTTTAAGTCA
AACTTTACAGCAACAAGCAAATGCTGGCCAAAAATATACTTTGGCATGGCTATTACAAGAAACACTGAAA
GCCATACAGGCATTAGAAAATAAAGGTAATGCAAGTGTGCCAATCAACCAGACAGGTGAATATGAACGGC
ATACGAAAGGAGACACTTTAGAGTTTGTAAGTTTGCAGGCCGATGCTTTAAATGCTCCTCCATGTGAAGG
TGCTGATTCCCAATCTGGAAAAAGTATTAGCTATTCAATTGGTGCTGAACGGGTTCAACATGCAGACTTC
TATTTACCGAAAATAGGTTTTTCTTTTATACGGCAATATAACTCACAAATGGATGAGTTTGATCAAAGTA
TGGTCGGTGCACGTTGGATGATGCCATTTTCCAATATGATTCAACAAAATGCCCAAGGCTATCTATTTAT
TGATAGTAAAGGGCGAAAGCATCAACTGCCGGTTTCCATTATATTTGAAACATATGAAGTACCTTATGAG
GGATGGATTATTAAACCCCTTAAAAATGGGGAATTAATTTTAGATTTTGGAGGTGAATGGAGATCTCATT
TTCAAAGCTTTGATGGGGGAAAAAACTATTATTTAGTTAAAAAAATGAATGAGACTTCTCAAGAGGAAAT
TCTTCTAGAGTATCTTTTGTTAGATCACATAGCATATTTAAAGGTTATCAATTTTAAATTGAAACAAGCA
GAGTATGAGCTGAAATTTGCTTTTAATGAGCAAGTTAAAATCATTGCGGTGTTTTTAGATGACAAAGCTG
AGCCATTAGCACGTTATGAATACGATACCCAAGGGAACTTAATTAAAGCTATTGATCAGAATGGCCATAC
AAGAACCTATGAATATAACCAATTTCATCAACTAACCCGTTATACAGACCGTACAGGGCGTGGACAAAAT
ATTCGGTACGAATCAACTGAAGCCAAAGCTAAAGCGATAGAAGAATGGGCTGATGATGGCAGTTTCCATA
CCAAACTAAAATGGCATCCGCGCTTACGCCAAGTGGCAGTTTATGATGCTTATGATGTTCCAACTTATTA
TTACTTCGATCTTGATGGGTTTACTTATCGAACTCGTTTAGCGGATGGGCGTGAGTCATGGTATAGCCGT
GATGGGAAAAAGCGCATTACTCGACAAATCGATTTTGATGGGCGAGAGACTCAACAAGAATACAATGATC
AAGATCAACTTGTTAAAATTGTTCAGCCAAACGGTGGGATAATTCGTTTTGCATATAATAAGCAGGGTAA
CTTAGTTGAAATTAAAGACCCAGAAGGTAGTATTTGGAAACGAGAATACGATGAAAATAGAAATGTTAGT
AAAGAAATCAATCCATTAGGGCATATCACACAGTACAAATATAACAATGATAATCAACTGGTTGAAGTCA
TTGATGCAAAAGGTGGTGTTAAGAAAATTCAGTATAATGAATTGGGGCAGATGATTTCATATACCGATTG
CTCAGGTAAGAGTAGTACATGGGAATATGATGAAGATGGTGCACTGACAGCTGAACAAACTGCAAATAAT
AAAGTTGTACAGTATTTTTACAGTACCAAAGGCCGAGATAAAGGACAGCTGCAAAGTATTATTTATCCTG
ATGGGTTAAAAGAATACTTTGAACATGATGAAGAAGGACGCTTACTTAAACATACCGATACCAAAGGTTT
AGTAACGGAATATAAGTACAATCAAGTTGGCTTATTAGAGCAGCGTATTGATGCCAATCGACATAGTGTA
GCTTATCAATGGGACAAACAAGGTCGCATTCAAAAGCTAATCAACCAGAATCAAGCCGAATATTTGTTTG
GATACAATCCGTATGGATATTTGATACGTGAACAGGCCTTTGATGGAGAGGAAAAGCACTATAGTTACAA
TGAAAATGGTCGATTATTTCAAATCCGTCGACCAAATATACTGACCCAATTTGACTATTATGCAGATGGA
CAAATTGCTTCGAAAAGTTTTACCCACTTACATACAGGGCAGAAACAAACAGAGCAATTTGACTATAACC
TCAATAGCCAACTGAGCCGAGCCAGTAATGAGGTTAGCCAAATTGATTTATATCGCAATGCACTTGGGCA
GTTGGTTAGAGAGCATCAGCATTATAAAATTCCAGAACTGAAACCGCTCACAGCAGTATTACATTATGAA
TATGATGAGCTTGGAAATTTAATTAAAACAATTCGACCTGATGGACATACACTGAATCATCTTGTTTATG
GTTCAGGGCATATTTATGCAATTGGTTTAAATAACCAAGAGGTTGTTTCATTTCAGCGTGATGATTTGCA
TAGAGAAACAACACGATTACTAGCAAATGGGCTCATGCAAACCAAACAATATAATGATGTGGGGTTATTG
AGTTCACAGTTCATTCAACCTGAGCAAGAAACTCAAGACTATTTACAATATCAAGCACATAGAAAATATC
ACTACGATAAAAACTATTTGCTTAGTCAAGTTGAAGATAGCCGTTTGGGTAAACTCAATTATCAATATGA
CCCAATTGGGCGTTTAATTGCAGCTCAAAGTTTACATAAAACAGAAAGCTTTAATTTTGACCCAGCAGGT
AACTTAATTGATTCTGAGTCGGTATTAAGTCCTGCACAAATTAAAAATAACCTTATTAAAAGTTATAAAG
GTAAACACTACCAATATGACGTTCAAGGTAATGTGACAGAGATTATTCAAGCGGGCAAAAACCTTAAACT
GACTTGGGATAATCAAAATAGACTTATTCGAAGTGATAATAATGGTCTAGTTACAGAATATGGTTACGAT
GTCTTTGGTCGTCGACTCTACAAAAAAACAGCCAAAGAATTAACCTTATTTGGTTGGGATGGAGATTTAA
TGATATGGGAGTCTTTTAAATCTGCACAGACCAATTATACAAAGCACTATATTTATGAACCTGATAGCTT
TGTTCCACTATTACAAGCAGGTTATAAGGATTTTATTCAACTGATAGAAACTCCTGATTATCAGGAATAT
CAAACAAAACCTTATTCTATTTATAAAGACCCAGTATGGAATCGTAATCTTGGTAAAGAGCGTACTGCTT
TAGAGCAGTTTACATTCTACCACTGTGATCAGGTCGGAACACCACAAACCATGACCAATATCCGAGGAGA
GTGTGTATGGGAAATTCTCCAAGATACATGGGGCGCGGTGTCGCAAATTAAAGCACTAAATCAAGATAAT
CCATTTGAACAAAATAATTTACGCTTTCAAGGCCAGTATTACGACCGTGAAACAGAACTGCACTATAACC
GTTATCGTTATTATGAACCTCATAGCGCAAGATATGTAAGTAAAGACCCGATTGGGTTAGAGGGTGGTAT
GAATACCTCTAGTTATGTAAGTGATCCAAATCAATGGATTGATCCAAAAGGATTAAATAGTTTTAATTAT
GGTGAAATGTTTGGTATTCCAGCTAGTGCCCAGTCAGGTCTAGCATATCAAGGTCAACGAAATTATGAGT
GTTATGCTGAAACAGGAGAATTATGTAAAATAAAAGTGCCACCATTATTTGATTATGTTGCATGTAGCGG
CGGAGGTTTAGGAATAGGAGTGGGCTTTGTTAAAAATCAATGGACTGGCGAATATTATATTAGTGGTTCG
AAGGATTCGCTATTAATTCCTGTAGCAAAATCAGTTGCTCAAAATAAACAATTTAGCGCTAAAGATCTGG
CAGGGGCTAGTTGTGTAGGTGGTAATATTCACAACATACCAAGTTATACCAAAACAACAATGACTATGGG
CGAGATTACAAATGAATTTGTAAGTGGAGCTTCAGTTACTGTTGGTGGTGGAGCTTATGGAGCAGTAGCA
AACGTAGTGGTTCCATTAGTAAGTAAAAGCAGTCCTGTAAAAGGTACGTGGGCCTCTGAGTTAGGAGTAG
GAACACCAGGTTTCAATGTAGGTGTGAGCGGTACTGTTAGTGTTGATACAATTTTAGATGCTGTGAAACC
TAGTAAGAAATAA

Reference
(1) Fitzsimons TC, Lewis JM, Wright A, Kleifeld O, Schittenhelm RB, Powell D, Harper M#, Boyce JD (2018). Identification of Novel Acinetobacter baumannii Type VI Secretion System Antibacterial Effector and Immunity Pairs. Infect Immun. 86(8). pii: e00297-18. [PudMed:29735524] experimental
 
experimental experimental literature