SecReT6
Effector Protein ID: 218552810
-
SecReT6 ID315
T6SS typeA1
Gene symbol-
Locus tagECIAI1_0244
StrainEscherichia coli IAI1
Repliconchromosome [GenBank: NC_011741] [Browse all T6SS(s) in this replicon]
Location [Strand]259913..260431 [+]
Producthypothetical protein
Effector typeProtein
Homologous effectorECA4275
DescriptionHcp protein
UniProt IDB7M234
KEGG IDecr:ECIAI1_0244
PDB IDNA
Domain hit(s) vs Pfam DUF796 [PF05638], Evalue: 1.10E-34, Aligned region: 6..155
DCAF15_WD40 [PF14939], Evalue: 0.0061, Aligned region: 95..136
Protein Sequence: 172 a.a.     [Download]
>gi|218552810|ref|YP_002385723.1| hypothetical protein ECIAI1_0244 [Escherichia coli IAI1]
MPTPCYISITGQTQGNITAGAFTADSVGNIYVQGHEDEMLVQEFLHNVTVPTDPQSGQPAGQRAHKPFIF
TVALNKAVPLMYNALASGEMLPTTELHWWRTSVEGKQEHYFTTRLTDSTIVDMKLHMPHCQDPAKREFTQ
LLEVSLAYRKIEWEHVKSGTSGADDWRAPLEA
-
Nucleotide Sequence: 519 bp     [Download]
>ref|NC_011741.1|:259913-260431 hypothetical protein ECIAI1_0244 [Escherichia coli IAI1]
ATGCCAACACCGTGTTATATCTCCATCACTGGTCAGACCCAGGGAAATATTACTGCAGGTGCATTTACCG
CTGATTCTGTCGGCAACATCTATGTGCAGGGGCACGAAGACGAGATGCTGGTGCAGGAATTCCTGCATAA
CGTTACTGTCCCGACCGATCCTCAGTCCGGCCAGCCTGCGGGTCAGCGTGCTCACAAGCCGTTCATTTTT
ACCGTGGCGCTGAACAAAGCGGTTCCGCTGATGTACAACGCACTGGCCTCCGGCGAAATGCTGCCAACCA
CTGAACTTCACTGGTGGCGTACCTCTGTGGAAGGCAAACAGGAGCATTATTTCACTACCCGCCTGACTGA
TTCGACGATTGTCGATATGAAACTGCATATGCCGCATTGCCAGGACCCGGCGAAACGCGAGTTCACCCAG
TTGCTCGAAGTTTCACTGGCCTACCGCAAAATTGAATGGGAACACGTCAAATCTGGCACCTCCGGTGCCG
ACGACTGGCGCGCACCGCTGGAAGCATAA