SecReT6
Effector Protein ID: 218676766
SecReT6 ID318
T6SS typeA1
Gene symbol-
Locus tagVS_II1005
StrainVibrio splendidus LGP32
Repliconchromosome II [GenBank: NC_011744] [Browse all T6SS(s) in this replicon]
Location [Strand]1114079..1114597 [-]
ProductHcp (Haemolysin co-regulated protein)
Effector typeProtein
Homologous effectorVEPGS_0021
DescriptionHcp protein
UniProt IDB7VTU2
KEGG IDvsp:VS_II1005
PDB IDNA
Domain hit(s) vs Pfam DUF796 [PF05638], Evalue: 1.00E-35, Aligned region: 6..156
Protein Sequence: 172 a.a.     [Download]
>gi|218676766|ref|YP_002395585.1| Hcp (Haemolysin co-regulated protein) [Vibrio splendidus LGP32]
MPTPAYMSINGETQGHITKDTYSADSVGNTWQEAHVDEFLVQELDHVLTVPRDPQSGQPTGQRVHRPVVV
TKVQDRCSPLLFNALVSGEKLPECVIRFYRTSVQGKQEHYYSIKLIDALLVDIQTRMNHCQDAATSDRVT
EEVLKLTYRAIEVTHENCGTAGNDDWRAPREA
-
Nucleotide Sequence: 519 bp     [Download]
>gi|294510242|ref|NC_011744.2|:c1114597-1114079 Vibrio splendidus LGP32 chromosome 2, complete sequence
ATGCCAACTCCAGCATATATGTCTATCAATGGTGAAACACAAGGTCACATTACTAAAGATACTTACTCTG
CAGATTCTGTAGGTAATACTTGGCAAGAAGCTCACGTTGATGAGTTCCTAGTTCAAGAACTTGATCACGT
ACTGACAGTTCCACGTGACCCACAAAGTGGCCAACCAACAGGTCAACGTGTTCACCGCCCTGTAGTAGTA
ACTAAAGTACAAGACCGTTGTTCACCTCTGTTATTCAACGCATTAGTGTCTGGCGAAAAGCTTCCAGAGT
GTGTAATCCGTTTCTACCGTACTTCAGTACAAGGTAAGCAAGAGCACTACTACTCAATCAAGTTAATTGA
TGCACTACTTGTAGATATCCAAACTCGTATGAATCACTGTCAAGACGCTGCAACTTCAGATCGTGTAACT
GAAGAAGTACTTAAGCTGACTTACCGTGCAATCGAAGTCACTCACGAAAACTGTGGTACTGCTGGTAACG
ATGACTGGCGTGCTCCACGCGAAGCTTAA