SecReT6
Effector Protein ID: 218693697
-
SecReT6 ID320
T6SS typeA1
Gene symbol-
Locus tagEC55989_0235
StrainEscherichia coli 55989
Repliconchromosome [GenBank: NC_011748] [Browse all T6SS(s) in this replicon]
Location [Strand]262463..262981 [+]
Producthypothetical protein
Effector typeProtein
Homologous effectorECA4275
DescriptionHcp protein
UniProt IDB7LHE1
KEGG IDeck:EC55989_0235
PDB IDNA
Domain hit(s) vs Pfam DUF796 [PF05638], Evalue: 1.10E-34, Aligned region: 6..155
DCAF15_WD40 [PF14939], Evalue: 0.0061, Aligned region: 95..136
Protein Sequence: 172 a.a.     [Download]
>gi|218693697|ref|YP_002401364.1| hypothetical protein EC55989_0235 [Escherichia coli 55989]
MPTPCYISITGQTQGNITAGAFTADSVGNIYVQGHEDEMLVQEFLHNVTVPTDPQSGQPAGQRAHKPFIF
TVALNKAVPLMYNALASGEMLPTTELHWWRTSVEGKQEHYFTTRLTDSTIVDMKLHMPHCQDPAKREFTQ
LLEVSLAYRKIEWEHVKSGTSGADDWRAPLEA
-
Nucleotide Sequence: 519 bp     [Download]
>gi|218693476|ref|NC_011748.1|:262463-262981 Escherichia coli 55989 chromosome, complete genome
ATGCCAACACCGTGTTATATCTCCATCACTGGTCAGACCCAGGGAAATATTACTGCAGGTGCATTTACCG
CTGATTCTGTCGGCAACATCTATGTGCAGGGGCACGAAGACGAGATGCTGGTGCAGGAATTCCTGCATAA
CGTTACTGTCCCGACCGATCCTCAGTCCGGTCAGCCTGCGGGTCAGCGTGCTCACAAGCCTTTCATTTTT
ACCGTGGCGCTGAACAAAGCGGTTCCGCTGATGTACAACGCACTGGCCTCCGGCGAAATGCTGCCAACCA
CTGAACTTCACTGGTGGCGTACCTCTGTGGAAGGCAAACAGGAGCATTATTTCACTACCCGCCTGACTGA
TTCGACGATTGTCGATATGAAACTGCATATGCCGCATTGCCAGGACCCGGCGAAACGCGAGTTCACCCAG
TTGCTCGAAGTTTCACTGGCCTACCGCAAAATTGAATGGGAACACGTCAAATCTGGCACCTCCGGTGCCG
ACGACTGGCGCGCACCGCTGGAAGCATAA