SecReT6
Effector Protein ID: 218696634
-
SecReT6 ID486
T6SS typeA2
Gene symbol-
Locus tagEC55989_3335
StrainEscherichia coli 55989
Repliconchromosome [GenBank: NC_011748] [Browse all T6SS(s) in this replicon]
Location [Strand]3422840..3423331 [-]
Producthypothetical protein
Effector typeProtein
Homologous effectorEC042_4529
DescriptionHcp protein
UniProt IDB7LG67, B7LG67
KEGG IDeck:EC55989_3335
PDB IDNA
Domain hit(s) vs Pfam DUF796 [PF05638], Evalue: 2.10E-36, Aligned region: 6..147
Protein Sequence: 163 a.a.     [Download]
>gi|218696634|ref|YP_002404301.1| hypothetical protein EC55989_3335 [Escherichia coli 55989]
MAIPVYLWLKDDGGADIKGSVDVQDREGSIEVVAQEHCLYIPTDNNTGKLTGTRIHTPFLFTKEIDSSSP
YLYKAVTTGQTLKSAEFKWYKINDAGQEVEYFNTKLENVKVVKVNPVMHDIKNPAYEKHNHLEQVELRYE
KITWTYKDGNIIHSDAWSERTTA
-
Nucleotide Sequence: 492 bp     [Download]
>gi|218693476|ref|NC_011748.1|:c3423331-3422840 Escherichia coli 55989 chromosome, complete genome
ATGGCAATTCCAGTTTATCTGTGGCTGAAAGATGATGGCGGTGCAGATATCAAAGGGTCCGTGGATGTTC
AGGACCGTGAGGGCAGCATTGAGGTGGTGGCTCAGGAGCACTGCCTCTACATCCCGACGGATAACAATAC
CGGTAAGCTGACCGGTACCCGTATTCACACGCCGTTTCTGTTTACCAAGGAAATTGATTCTTCCAGCCCG
TACCTTTACAAGGCCGTGACCACCGGGCAGACCCTGAAGTCTGCTGAGTTTAAGTGGTACAAAATCAATG
ATGCCGGTCAGGAGGTGGAGTATTTCAATACGAAGCTTGAGAACGTGAAGGTGGTGAAGGTTAACCCGGT
CATGCACGACATCAAGAATCCCGCTTACGAGAAGCATAACCACCTTGAGCAGGTGGAACTGCGCTACGAG
AAAATCACCTGGACTTACAAGGACGGCAACATCATTCATTCCGACGCATGGAGTGAGCGTACCACCGCGT
AA