SecReT6
Effector Protein ID: 218890268
SecReT6 ID324
T6SS typeA3
Gene symbol-
Locus tagPLES_15281
StrainPseudomonas aeruginosa LESB58
Repliconchromosome [GenBank: NC_011770] [Browse all T6SS(s) in this replicon]
Location [Strand]1658764..1659990 [-]
Producthypothetical protein
Effector typeProtein
Homologous effectorPA3484
DescriptionTse3
UniProt IDB7UWJ6
KEGG IDpag:PLES_15281
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 408 a.a.     [Download]
>gi|218890268|ref|YP_002439132.1| unnamed protein product [Pseudomonas aeruginosa LESB58]
MTATSDLIESLISYSWDDWQVTRQEARRVIAAIRNDNVPDATIAALDKSGSLIKLFQRVGPPELARSLIA
SIAGRTTMQRYQARNALIRSLINNPLGTQTDNWIYFPTITFFDICADLADAAGRLGFAAAGATGVASQAI
QGPFSGVGATGVNPTDLPSIAFGDQLKLLNKDPATVTKYSNPLGDLGAYLSQLSPQDKLNQAQTLVGQPI
STLFPDAYPGNPPSRAKVMSAAARKYDLTPQLIGAIILAEQRDQTRDEDAKDYQAAVSIKSANTSIGLGQ
VVVSTAIKYELFTDLLGQPVRRGLSRKAVATLLASDEFNIFATARYIRYVANLASQQDLRKLPKTRGAFP
SIDLRAYAGNPRNWPRDNVRALASEYTSRPWDDNLSPGWPMFVDDAYATFLDPGMRFP
-
Nucleotide Sequence: 1227 bp     [Download]
>gi|218888746|ref|NC_011770.1|:c1659990-1658764 Pseudomonas aeruginosa LESB58 chromosome, complete genome
ATGACCGCCACCAGCGACCTGATCGAGTCACTGATTTCCTATAGCTGGGACGACTGGCAGGTGACCCGCC
AGGAAGCCCGCCGGGTGATCGCCGCGATCCGCAACGACAACGTGCCCGATGCGACCATCGCCGCACTCGA
CAAGAGCGGCTCGCTGATCAAGCTGTTCCAGCGGGTGGGCCCGCCGGAACTGGCGCGCTCGCTGATCGCC
AGCATCGCCGGGCGCACCACCATGCAGCGCTACCAGGCACGCAATGCCTTGATCCGCAGCCTGATCAACA
ATCCCCTGGGCACCCAGACCGACAACTGGATCTACTTCCCCACCATCACCTTCTTCGACATCTGCGCCGA
CCTCGCCGACGCCGCCGGTCGCCTGGGCTTCGCCGCGGCGGGAGCCACCGGGGTGGCCAGCCAGGCGATC
CAGGGTCCGTTCAGCGGGGTCGGCGCCACCGGCGTCAATCCGACCGACCTGCCGTCCATTGCCTTCGGCG
ACCAGCTCAAGCTGCTCAACAAGGACCCGGCGACCGTCACCAAGTACAGCAACCCGCTCGGCGACCTGGG
CGCCTACCTGAGCCAGCTGTCGCCGCAAGACAAGCTGAACCAGGCACAGACGCTGGTCGGCCAGCCGATC
AGCACGCTGTTCCCCGACGCCTATCCGGGCAACCCGCCGTCGCGGGCCAAGGTCATGTCCGCGGCCGCGC
GCAAGTACGACCTGACGCCGCAACTGATCGGCGCGATCATCCTCGCCGAGCAGCGTGACCAGACCCGCGA
CGAAGACGCCAAGGACTATCAGGCGGCAGTCAGCATCAAGAGCGCCAACACCTCCATCGGCCTCGGCCAG
GTGGTGGTCTCCACCGCGATCAAGTACGAGCTGTTCACCGACCTGCTCGGCCAGCCGGTGCGCCGCGGTC
TGTCGCGCAAGGCGGTCGCCACCCTGCTGGCTTCCGACGAATTCAACATCTTCGCCACCGCCCGTTACAT
CCGCTACGTCGCCAACCTGGCGTCGCAACAGGACCTGCGCAAGCTGCCGAAGACCCGCGGTGCATTTCCC
TCCATCGATCTCCGCGCCTACGCCGGCAATCCGCGCAACTGGCCGCGGGACAATGTCCGCGCGCTGGCCT
CGGAATACACCTCGCGGCCCTGGGACGACAACCTGTCGCCGGGCTGGCCGATGTTCGTCGACGATGCCTA
CGCCACCTTCCTCGACCCTGGAATGAGGTTCCCATGA