SecReT6
Effector Protein ID: 218891037
-
SecReT6 ID324
T6SS typeA3
Gene symbol-
Locus tagPLES_23001
StrainPseudomonas aeruginosa LESB58
Repliconchromosome [GenBank: NC_011770] [Browse all T6SS(s) in this replicon]
Location [Strand]2470835..2471422 [+]
Producthypothetical protein
Effector typeProtein
Homologous effectorPA2774
DescriptionTse4
UniProt IDB7UYT7
KEGG IDpag:PLES_23001
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 195 a.a.     [Download]
>gi|218891037|ref|YP_002439903.1| unnamed protein product [Pseudomonas aeruginosa LESB58]
MSQLPIPLPLNESRWRYVTASGGGMTVAFLAGSGGSITLLSPEGENVSFRYGGVGGGIGLGMRLPRFGKV
NLNVKGKSVGGAGALEALPSTGTVLVADGLVGRDLSRGDFTGPCMYVELGAGVIAGGSGTAILFGLDPKL
LAAVALASASPLTAALGASMSRQLLQSSRGALLMAGVNVGAQFGGGAAAYLGALF
-
Nucleotide Sequence: 588 bp     [Download]
>gi|218888746|ref|NC_011770.1|:2470835-2471422 Pseudomonas aeruginosa LESB58 chromosome, complete genome
ATGTCGCAACTTCCCATTCCCTTGCCCCTCAACGAGAGTCGCTGGCGCTACGTGACGGCCAGTGGCGGAG
GCATGACCGTGGCCTTCCTGGCGGGTAGCGGCGGCTCCATCACGTTGCTCTCGCCGGAGGGTGAGAACGT
GTCCTTCCGCTATGGCGGGGTGGGCGGCGGGATCGGACTGGGCATGCGCCTGCCGCGCTTCGGCAAGGTC
AACCTCAATGTCAAGGGCAAGAGCGTTGGCGGGGCCGGTGCGCTGGAGGCGTTGCCGAGCACCGGAACCG
TCTTGGTCGCGGACGGCCTGGTGGGGCGCGACCTGTCCCGCGGCGACTTCACCGGGCCCTGCATGTACGT
CGAACTCGGCGCGGGAGTCATCGCCGGCGGTTCGGGCACGGCGATCCTCTTCGGCCTCGATCCCAAGCTG
CTGGCGGCGGTGGCGCTGGCGAGCGCCTCGCCATTGACCGCCGCGCTGGGCGCCAGCATGTCGCGGCAAT
TACTGCAATCGTCCCGTGGCGCCCTGTTGATGGCCGGGGTCAACGTCGGTGCACAGTTCGGCGGCGGCGC
GGCGGCTTACCTGGGGGCGTTGTTCTGA