SecReT6
Effector Protein ID: 218891154
SecReT6 ID324
T6SS typeA3
Gene symbol-
Locus tagPLES_24191
StrainPseudomonas aeruginosa LESB58
Repliconchromosome [GenBank: NC_011770] [Browse all T6SS(s) in this replicon]
Location [Strand]2598904..2601084 [+]
Producthypothetical protein
Effector typeProtein
Homologous effectorPA2685
Descriptiontype VI secretion system Vgr family protein
UniProt IDB7V817
KEGG IDpag:PLES_24191
PDB IDNA
Domain hit(s) vs Pfam Phage_GPD [PF05954], Evalue: 8.00E-86, Aligned region: 66..366
Phage_GPD [PF05954], Evalue: 8.00E-86, Aligned region: 384..431
Phage_base_V [PF04717], Evalue: 7.40E-26, Aligned region: 406..499
Gp5_C [PF06715], Evalue: 1.20E-08, Aligned region: 551..571
Gp5_C [PF06715], Evalue: 1.20E-08, Aligned region: 566..588
Gp5_C [PF06715], Evalue: 1.20E-08, Aligned region: 574..597
Gp5_C [PF06715], Evalue: 1.20E-08, Aligned region: 590..612
Gp5_C [PF06715], Evalue: 1.20E-08, Aligned region: 642..652
Gp5_C [PF06715], Evalue: 1.20E-08, Aligned region: 657..671
DUF2345 [PF10106], Evalue: 4.80E-05, Aligned region: 682..720
Protein Sequence: 726 a.a.     [Download]
>gi|218891154|ref|YP_002440020.1| unnamed protein product [Pseudomonas aeruginosa LESB58]
MAIGQPFATALGCTIIWRAAGALFGPPAAGDYQGRFPMLFSQHTRLVHVDSPLGPEVLQLQRLEGREELG
RLFSHELELVSSNPALPLDALLGKPMSLALELPGGSRRYFHGIVARCSQGAGAGQFASYQVTLRPWLWLL
TRTSDCRIFQNQKVPDIIKQVFRDLGFSDFEDALSRSYREWEYCVQYRETSFDFVSRLMEQEGIYYWFRH
EKKRHILVLSDAYGAHHSPAGYTSVPYYPPSLGHRERDHFFDWHMAREVQPGSLSLNDYDFQRPGTRLEV
RSNVGRAHAAADYPLYDYPGEYVQSQDGEHYARTRIEAIQTQYERVRLRGCARGIGAGHLFHLSNYPRLD
QNREYLVVGAEYRVVQELYETGNGGGGAQFESELDCIDAGQAFRPLPSTPVPVVRGPQTAVVVGPKGEEI
WTDQYGRVKVHFHWDRHDQSNENSSCWMRVSQAWAGKNWGSIQIPRIGQEVIVSFLEGDPDRPIITGRVY
NAEQTVPYELPANATQSGTKSRSSKGGTPANFNEIRMEDKKGAEQLFIHAERNQDIEVENDETHWVGHDR
TKTIDHDETVHVKHDRTETVDNNETITVHANRSKTVDRNETVRIGMNKTETILMASLQNVGMGRMENVGL
GYSLNVGMMMNTVVGLNQSTQVMKKKTLSVGDSYEVSVGGSDDGSKITLDGQSITLGSQRIELTADREIL
LRCGQSTIRLTPGEIEILSPNVDINC
-
Nucleotide Sequence: 2181 bp     [Download]
>gi|218888746|ref|NC_011770.1|:2598904-2601084 Pseudomonas aeruginosa LESB58 chromosome, complete genome
GTGGCTATTGGCCAGCCTTTCGCGACGGCACTGGGTTGTACGATCATCTGGCGCGCTGCTGGCGCGTTGT
TCGGGCCGCCCGCCGCAGGTGACTATCAAGGAAGATTCCCCATGCTGTTCTCCCAACACACCCGCCTGGT
ACACGTGGACTCCCCGCTGGGACCCGAGGTCCTGCAACTGCAACGGCTGGAGGGTCGCGAAGAGCTGGGC
CGGCTGTTCAGCCACGAGCTCGAACTGGTCTCGAGCAATCCCGCCTTGCCTCTGGATGCCCTGTTGGGCA
AGCCGATGAGCCTCGCGCTGGAACTCCCCGGCGGCAGCCGGCGGTATTTCCACGGCATCGTCGCGCGCTG
TAGCCAGGGCGCCGGCGCCGGCCAGTTCGCCAGCTACCAGGTCACCCTGCGGCCCTGGCTGTGGCTGCTG
ACGCGCACCTCCGACTGCCGCATCTTCCAGAACCAGAAGGTCCCGGACATCATCAAGCAGGTGTTCCGCG
ACCTTGGCTTCTCCGACTTCGAGGACGCCCTGAGCCGCTCCTACCGCGAGTGGGAATACTGTGTGCAATA
CCGCGAGACCAGCTTCGATTTCGTCAGCCGGCTGATGGAGCAGGAAGGCATCTACTACTGGTTCCGCCAC
GAAAAGAAGCGCCACATCCTGGTGCTCTCCGATGCCTACGGCGCGCACCACAGCCCGGCCGGCTACACAA
GCGTGCCCTATTACCCGCCGAGCCTCGGCCATCGCGAGCGCGACCACTTCTTCGACTGGCACATGGCGCG
CGAGGTCCAGCCCGGCTCGCTAAGCCTCAACGACTACGACTTCCAGCGTCCCGGCACCCGCCTGGAAGTG
CGCTCCAATGTCGGGCGCGCCCATGCCGCGGCCGACTACCCGCTCTACGACTACCCTGGCGAGTATGTGC
AGAGCCAGGACGGCGAACACTATGCACGGACCCGCATCGAGGCGATCCAGACCCAGTACGAGCGAGTTCG
CCTGCGGGGATGCGCCAGGGGTATCGGGGCGGGCCATCTGTTCCACCTGAGCAACTACCCGCGCCTGGAC
CAGAACCGCGAATACCTGGTGGTTGGCGCCGAGTACCGGGTAGTCCAGGAACTCTACGAGACCGGTAATG
GCGGGGGCGGCGCGCAGTTCGAGAGCGAGCTGGACTGTATCGACGCCGGCCAGGCTTTCCGCCCCTTGCC
GTCGACCCCGGTGCCGGTGGTGCGCGGCCCGCAGACCGCGGTGGTGGTCGGGCCCAAGGGCGAGGAGATC
TGGACCGACCAGTATGGCCGGGTCAAGGTGCATTTCCACTGGGACCGCCACGACCAGTCCAACGAGAACA
GCTCCTGCTGGATGCGCGTCTCGCAGGCCTGGGCCGGGAAGAACTGGGGCTCGATCCAGATCCCGCGGAT
CGGCCAGGAAGTGATCGTCAGCTTCCTCGAAGGAGACCCGGACCGGCCGATCATCACCGGGCGGGTCTAC
AACGCCGAGCAGACGGTGCCCTACGAGCTGCCGGCGAACGCTACCCAGAGCGGCACCAAGAGCCGTTCGA
GCAAGGGCGGCACGCCGGCCAACTTCAACGAGATCCGCATGGAGGACAAGAAGGGCGCCGAGCAGTTGTT
CATCCATGCCGAGAGGAACCAGGACATCGAGGTCGAGAACGACGAGACCCACTGGGTCGGCCACGACCGG
ACCAAGACCATCGACCACGACGAGACGGTGCATGTGAAGCACGATCGCACCGAGACCGTGGACAACAACG
AGACCATCACCGTGCATGCCAACCGCAGCAAGACGGTCGACCGCAACGAGACGGTCAGGATCGGCATGAA
CAAGACGGAAACCATCCTCATGGCCTCGTTGCAGAACGTCGGCATGGGGCGCATGGAAAACGTCGGGCTC
GGCTACAGCCTGAACGTCGGCATGATGATGAACACCGTGGTCGGGCTGAACCAGAGCACCCAGGTGATGA
AGAAGAAGACCTTGTCGGTGGGCGATAGCTACGAAGTGAGCGTGGGCGGCAGCGACGATGGCTCTAAGAT
CACCCTGGACGGTCAGAGCATCACCCTCGGCAGCCAGCGCATCGAGCTGACCGCCGACCGCGAGATCCTC
TTGCGCTGCGGCCAGAGCACGATCCGCCTGACGCCGGGGGAGATCGAGATCCTCTCGCCCAATGTCGATA
TCAACTGTTGA