SecReT6
Effector Protein ID: 218891155
-
SecReT6 ID324
T6SS typeA3
Gene symbol-
Locus tagPLES_24201
StrainPseudomonas aeruginosa LESB58
Repliconchromosome [GenBank: NC_011770] [Browse all T6SS(s) in this replicon]
Location [Strand]2601134..2605087 [+]
Producthypothetical protein
Effector typeProtein
Homologous effectorPA2684
DescriptionTse5
UniProt IDB7V818
KEGG IDpag:PLES_24201
PDB IDNA
Domain hit(s) vs Pfam RHS_repeat [PF05593], Evalue: 5.40E-54, Aligned region: 198..220
RHS_repeat [PF05593], Evalue: 5.40E-54, Aligned region: 274..290
RHS_repeat [PF05593], Evalue: 5.40E-54, Aligned region: 320..338
RHS_repeat [PF05593], Evalue: 5.40E-54, Aligned region: 343..361
RHS_repeat [PF05593], Evalue: 5.40E-54, Aligned region: 381..415
RHS_repeat [PF05593], Evalue: 5.40E-54, Aligned region: 426..461
RHS_repeat [PF05593], Evalue: 5.40E-54, Aligned region: 472..500
RHS_repeat [PF05593], Evalue: 5.40E-54, Aligned region: 489..524
RHS_repeat [PF05593], Evalue: 5.40E-54, Aligned region: 531..567
RHS_repeat [PF05593], Evalue: 5.40E-54, Aligned region: 578..609
RHS_repeat [PF05593], Evalue: 5.40E-54, Aligned region: 615..642
RHS_repeat [PF05593], Evalue: 5.40E-54, Aligned region: 636..670
RHS_repeat [PF05593], Evalue: 5.40E-54, Aligned region: 685..709
RHS_repeat [PF05593], Evalue: 5.40E-54, Aligned region: 703..740
RHS_repeat [PF05593], Evalue: 5.40E-54, Aligned region: 767..778
RHS_repeat [PF05593], Evalue: 5.40E-54, Aligned region: 816..834
RHS_repeat [PF05593], Evalue: 5.40E-54, Aligned region: 821..855
RHS_repeat [PF05593], Evalue: 5.40E-54, Aligned region: 842..870
RHS_repeat [PF05593], Evalue: 5.40E-54, Aligned region: 924..942
RHS_repeat [PF05593], Evalue: 5.40E-54, Aligned region: 948..981
RHS [PF03527], Evalue: 1.60E-16, Aligned region: 497..516
RHS [PF03527], Evalue: 1.60E-16, Aligned region: 1065..1104
Protein Sequence: 1317 a.a.     [Download]
>gi|218891155|ref|YP_002440021.1| unnamed protein product [Pseudomonas aeruginosa LESB58]
MSGLPVSHVGEKVSGGVISTGSPTVHVGSSAVGLADRVSACVPLVGKPVNPMLGSKLLPEEVDFALAAPD
TFTFARGYLSSNPRIGRLGRGWWLPGESMHLELSEDACVLVDAQGRRIGFPALAPGAQHYSGSEELWLRR
GGSSGGEAQAWRGRWAAVPAELQTQEGSVLVLSGHSYLHFQRCPDGIWRLQASFGRAGYRTEFRWSGRGL
LTGVRDSAGRSYALVYQQACEPSEGDDGLRLFGVILASHDGPPPDYIDPQSPGLDWLVRYQFSDSGDLIA
VRDRLGQVVRVFAWREHMLVAHGEPGGLEVRYEWDVHAPHGRVVKQIEAGGLTRTFRYLRDATEVSDSLG
RVERYEFAGEGGQRRWTALVRADGSRSEFDYDLFGRLVAMRDPLGRETRRRRDGQGRMLEEESPGKARYR
KRVDEETGLLVELEDAMQRRWTFERDERGNATTVRGPAGSTRYAYEDPRLPDRPTRIVDPRGGERRLEWN
RFGLLAALTDCSGQVWRYDYDNEGRLVASSDPLGQLTRRRYDPLGQLIGLELADGSALSYEYDALGRQTR
IADAEGHATLFSWGHGDLLVRVSDAGGGELSYLHDEAGRLVALTNENGVQAQFRYDLLDRLVEETGFDGR
RQRYRYNAADELIAREDADGRETTYAYDRDGRLASIRVPATEHAPALVERYRWLADGRLASAGGADCEVR
YTYDEVGNLRLESQVHADGWVYSVEHSHDALGVRQTSRYGDAPPVAWLTYGPGHLHGALVGAVELAFERD
ALHREVRRDARRDGQDDALFTQERQHAPLGRLQRSRLRLAGGFDWQRGYRYDGLGQLVGIDDNQYLSVRY
EYDLGGRLLASRRAGAAASTYRYDAAGNRLEGVGEYAREDARQAFAENELYRSGFSRSEARANQAGEGPA
RWAGNRVERIAGNRYRFDALGNLVERIGADGERLRLAYDGAQRLVHLTRDYADGTRLEARYRYDALSRRI
AKVVLRDGVEQQVRFGWDGDRQCAEAFARELRTTVHEPGGFVPLLRLEQACEPDPPELLQLRQAFAAEGQ
PLPAQCVPALGEARIAFFHTDHLGTPLQLSDERGQLRWQGVPDDWRAVAPERQPGAQPIRFQGQYHDEES
GLYYNRYRYYLPEAGRYASQDPLGLGGGPNPYAYALNAPTLAYDPTGLIIPLVVIGAFAARAAIGAALGA
GIELGMQTGKQVLGQMKDNWDSDRDLTDIKWKCIDINWKHVGASAAIGTVAPGMLSTGKTVVQSAKAIRT
LSGQAANTANRAAKLAARKAAHADTIKKAVATQAAWQTGKQIVKCPLKDEEEECPPQ
-
Nucleotide Sequence: 3954 bp     [Download]
>gi|218888746|ref|NC_011770.1|:2601134-2605087 Pseudomonas aeruginosa LESB58 chromosome, complete genome
ATGAGCGGCCTACCGGTTTCCCATGTCGGCGAGAAAGTCTCGGGAGGGGTTATCTCCACCGGCTCGCCCA
CCGTGCACGTCGGCAGCAGCGCGGTCGGCCTGGCCGACCGGGTGTCCGCCTGCGTGCCGTTGGTGGGCAA
GCCGGTCAACCCGATGCTCGGCAGCAAGCTGCTGCCGGAAGAGGTCGATTTCGCCCTGGCGGCGCCGGAC
ACCTTCACCTTCGCCCGTGGCTACCTGTCGAGCAACCCCCGTATCGGCCGGCTCGGCCGGGGCTGGTGGC
TGCCGGGCGAGAGCATGCACCTGGAACTGAGCGAAGACGCCTGCGTGCTGGTCGACGCCCAGGGCCGCCG
GATCGGCTTTCCTGCGCTGGCTCCCGGCGCCCAGCATTATTCCGGCAGCGAGGAGCTGTGGCTGCGCCGC
GGCGGTTCGAGCGGCGGCGAAGCGCAGGCCTGGCGCGGGCGCTGGGCGGCGGTGCCGGCCGAACTGCAGA
CGCAGGAGGGCTCCGTGCTGGTGCTGTCCGGCCACAGCTACCTGCATTTCCAGCGTTGCCCCGACGGTAT
CTGGCGCCTGCAGGCCAGCTTCGGCCGCGCCGGCTACCGCACCGAGTTCCGCTGGAGCGGACGTGGCCTG
CTCACCGGCGTGCGCGATAGCGCCGGGCGCAGCTATGCGCTGGTCTACCAGCAAGCCTGCGAGCCGAGCG
AGGGCGACGACGGCCTGCGTCTGTTCGGCGTGATCCTGGCCAGCCACGACGGACCGCCTCCGGACTACAT
CGATCCGCAGAGCCCGGGGCTCGACTGGCTGGTGCGCTACCAGTTCAGCGACAGCGGCGATCTGATCGCC
GTGCGCGACCGTCTTGGCCAGGTGGTCCGGGTATTCGCCTGGCGCGAGCACATGCTGGTCGCCCACGGCG
AACCGGGCGGGCTGGAGGTTCGCTACGAGTGGGATGTCCATGCTCCGCACGGGCGGGTCGTGAAGCAGAT
CGAGGCGGGCGGCCTGACCCGTACCTTCCGCTACCTGCGCGATGCCACCGAGGTCAGCGACAGCCTCGGC
CGCGTCGAACGCTACGAGTTCGCCGGCGAGGGCGGGCAGCGGCGCTGGACCGCGCTGGTCAGGGCCGACG
GCAGCCGTAGCGAGTTCGACTACGACCTGTTCGGCCGCCTGGTCGCCATGCGCGATCCGCTGGGACGGGA
GACGCGGCGCCGGCGCGATGGCCAGGGGCGGATGCTCGAGGAGGAGTCGCCGGGCAAGGCGCGCTATCGC
AAGCGCGTCGACGAAGAGACCGGGCTGCTGGTCGAGCTGGAGGACGCGATGCAGCGCCGCTGGACCTTCG
AGCGCGACGAACGGGGCAATGCGACGACGGTGCGCGGCCCGGCCGGCAGCACCCGCTACGCCTACGAAGA
CCCGCGCCTGCCCGACCGGCCGACGCGAATCGTCGACCCGCGCGGCGGCGAGCGGCGCCTGGAGTGGAAC
CGCTTCGGCCTGTTGGCCGCGTTGACCGATTGTTCCGGCCAGGTCTGGCGTTACGACTACGACAACGAAG
GACGTTTGGTCGCCAGCAGCGACCCGCTGGGACAACTGACCCGGCGCCGCTACGACCCGCTGGGGCAACT
GATCGGCCTGGAATTGGCCGACGGCAGCGCCCTGAGCTATGAATACGACGCCCTTGGGCGGCAGACCCGT
ATCGCCGATGCCGAGGGGCACGCCACGCTGTTTTCCTGGGGGCACGGCGATCTGCTGGTGCGGGTTTCCG
ACGCCGGCGGCGGCGAATTGTCCTACCTGCACGACGAAGCCGGCAGGCTGGTCGCCCTGACCAACGAGAA
CGGCGTCCAGGCGCAGTTCCGCTACGACCTGCTGGACCGTCTGGTGGAAGAGACCGGCTTCGACGGTCGT
CGCCAACGCTATCGCTACAACGCCGCTGACGAACTGATCGCCCGCGAGGATGCCGACGGTCGCGAGACCA
CCTATGCCTACGACCGCGACGGCCGCCTGGCGAGCATCCGGGTTCCCGCCACCGAGCACGCACCGGCCCT
GGTCGAGCGTTACCGCTGGTTGGCCGACGGCCGCCTGGCCAGCGCCGGCGGGGCGGATTGCGAGGTGCGC
TACACGTACGACGAGGTCGGTAACCTGCGCCTGGAAAGCCAGGTACATGCCGACGGTTGGGTCTACAGCG
TCGAGCACAGCCACGACGCGCTAGGCGTGCGCCAGACCAGCCGCTACGGCGACGCGCCGCCGGTCGCCTG
GCTGACCTATGGCCCGGGTCATCTGCACGGCGCGCTGGTCGGTGCGGTCGAGCTGGCCTTCGAGCGCGAT
GCCCTGCACCGTGAGGTGCGTCGCGACGCCCGCCGCGACGGGCAGGATGACGCGTTGTTCACCCAGGAGC
GCCAGCACGCGCCGCTGGGACGCCTGCAGCGCAGCCGCCTGCGTCTGGCCGGCGGTTTCGACTGGCAGCG
CGGCTATCGCTACGACGGACTTGGACAACTGGTCGGCATCGACGACAACCAGTATCTGTCGGTGCGCTAC
GAATACGACCTCGGCGGTCGCCTGCTGGCCAGCCGGCGCGCTGGCGCGGCGGCCAGCACCTACCGCTACG
ACGCCGCCGGCAACCGCCTGGAGGGCGTCGGCGAGTACGCGCGCGAGGACGCTCGCCAGGCATTCGCCGA
GAACGAACTGTACCGCTCCGGTTTCAGTCGCTCCGAGGCGCGCGCGAACCAGGCCGGCGAAGGCCCGGCG
CGCTGGGCCGGCAACCGCGTGGAGAGGATCGCCGGCAACCGCTATCGCTTCGATGCGCTGGGCAACCTGG
TCGAGCGTATCGGCGCCGACGGCGAGCGCCTGCGCCTGGCCTACGACGGCGCGCAGCGCCTGGTCCATCT
GACGCGCGATTACGCCGACGGTACGCGGCTGGAGGCGCGCTACCGCTACGACGCGCTGTCGCGACGGATC
GCCAAGGTGGTGCTGCGCGACGGTGTCGAGCAGCAGGTGCGCTTCGGCTGGGACGGCGATCGCCAATGCG
CCGAAGCCTTTGCGCGGGAACTACGCACCACCGTTCACGAACCGGGCGGTTTCGTCCCGTTGCTGCGCCT
GGAGCAGGCCTGCGAGCCCGATCCCCCGGAGCTGCTGCAACTGCGCCAGGCGTTCGCCGCCGAAGGCCAG
CCGCTGCCGGCGCAATGCGTGCCGGCGCTGGGCGAGGCGCGGATCGCTTTCTTCCACACCGATCACCTCG
GTACCCCCCTGCAGCTGAGCGACGAACGTGGCCAACTGCGTTGGCAGGGCGTTCCGGACGACTGGCGGGC
GGTAGCGCCGGAACGACAGCCGGGTGCGCAGCCGATCCGCTTCCAGGGGCAGTACCACGATGAGGAAAGC
GGCCTCTACTACAACCGCTACCGTTATTACCTGCCGGAAGCCGGGCGCTATGCCAGCCAGGACCCGCTCG
GCCTGGGCGGTGGCCCCAACCCCTATGCCTACGCGCTGAACGCGCCCACGCTGGCCTACGATCCCACCGG
CCTGATCATCCCGCTGGTGGTGATCGGCGCCTTCGCCGCCCGCGCCGCGATCGGAGCGGCGCTGGGCGCC
GGCATCGAGCTGGGGATGCAGACCGGCAAGCAGGTGCTGGGGCAGATGAAGGACAACTGGGACAGCGATC
GCGACCTCACCGATATCAAGTGGAAGTGCATCGACATCAACTGGAAACACGTCGGCGCCTCGGCGGCCAT
CGGCACCGTGGCGCCGGGCATGCTCAGCACCGGCAAGACCGTGGTGCAGTCCGCCAAGGCGATCAGGACC
CTTTCCGGACAGGCGGCCAACACCGCCAACCGCGCGGCCAAGCTGGCCGCGCGCAAGGCCGCCCATGCCG
ATACCATCAAGAAGGCCGTGGCCACCCAGGCCGCCTGGCAGACGGGCAAGCAGATCGTCAAATGCCCACT
GAAGGACGAAGAAGAGGAGTGCCCGCCGCAATGA