SecReT6
Effector Protein ID: 218892200
-
SecReT6 ID324
T6SS typeA3
Gene symbol-
Locus tagPLES_34811
StrainPseudomonas aeruginosa LESB58
Repliconchromosome [GenBank: NC_011770] [Browse all T6SS(s) in this replicon]
Location [Strand]3863751..3864215 [+]
Producthypothetical protein
Effector typeProtein
Homologous effectorPA1844
DescriptionTse1
UniProt IDB7VB31
KEGG IDpag:PLES_34811
PDB IDNA
Domain hit(s) vs Pfam CHAP [PF05257], Evalue: 0.00025, Aligned region: 29..97
CHAP [PF05257], Evalue: 0.00025, Aligned region: 103..130
NLPC_P60 [PF00877], Evalue: 0.0012, Aligned region: 23..98
NLPC_P60 [PF00877], Evalue: 0.0012, Aligned region: 134..153
Protein Sequence: 154 a.a.     [Download]
>gi|218892200|ref|YP_002441067.1| unnamed protein product [Pseudomonas aeruginosa LESB58]
MDSLDQCIVNACKNSWDKSYLAGTPNKDNCSGFVQSVAAELGVPMPRGNANAMVDGLEQSWTKLASGAEA
AQKAAQGFLVIAGLKGRTYGHVAVVISGPLYRQKYPMCWCGSIAGAVGQSQGLKSVGQVWNRTDRDRLNY
YVYSLASCSLPRAS
-
Nucleotide Sequence: 465 bp     [Download]
>gi|218888746|ref|NC_011770.1|:3863751-3864215 Pseudomonas aeruginosa LESB58 chromosome, complete genome
ATGGACAGTCTCGATCAATGCATCGTCAACGCCTGCAAGAACAGCTGGGACAAGAGCTACCTGGCCGGCA
CCCCGAACAAGGACAACTGTTCCGGCTTCGTCCAGTCGGTGGCCGCCGAGCTGGGCGTACCGATGCCCCG
CGGCAACGCCAACGCCATGGTCGACGGCCTGGAGCAGAGCTGGACCAAGCTCGCCTCCGGCGCCGAGGCC
GCGCAGAAGGCGGCCCAGGGCTTCCTGGTGATCGCCGGCCTGAAGGGCCGCACCTACGGGCACGTCGCGG
TGGTCATCAGCGGTCCGCTGTATCGGCAGAAGTACCCGATGTGCTGGTGCGGCAGCATCGCCGGCGCGGT
CGGCCAGAGCCAGGGCCTGAAGTCGGTCGGCCAGGTATGGAATCGCACCGACCGCGACCGCCTCAACTAC
TACGTCTACTCCCTGGCCAGTTGCAGCCTGCCCAGGGCCAGTTGA