SecReT6
Effector Protein ID: 22123957
-
SecReT6 ID29
T6SS typeA1
Gene symbol-
Locus tagy0036
StrainYersinia pestis KIM10+
Repliconchromosome [GenBank: NC_004088] [Browse all T6SS(s) in this replicon]
Location [Strand]49742..50260 [-]
Producthypothetical protein
Effector typeProtein
Homologous effectorECA2866
DescriptionHcp protein
UniProt IDQ7CLD4
KEGG IDypm:YP_3069, ypk:y0036, ype:YPO3708
PDB IDNA
Domain hit(s) vs Pfam DUF796 [PF05638], Evalue: 3.00E-36, Aligned region: 6..156
Protein Sequence: 172 a.a.     [Download]
>gi|22123957|ref|NP_667380.1| hypothetical protein y0036 [Yersinia pestis KIM10+]
MPTPAYISITGKTQGNITAGAFTAESVGNIYVQGHEDEMLVQEFEHIVTVPTDPQSGQPSGQRAHKPLRF
TVAYNKAVPLLYNALASGEMLPTVELKWYRTSIEGKQEHFFTTKLEDATIIDIDCKMPHCQDSTKAEFTQ
LVRVSLAYRKINWDHTTAGTSGADDWRAPIEA
-
Nucleotide Sequence: 519 bp     [Download]
>gi|22123922|ref|NC_004088.1|:c50260-49742 Yersinia pestis KIM 10 chromosome, complete genome
ATGCCAACTCCAGCTTATATCTCTATCACAGGGAAAACGCAGGGCAATATTACCGCAGGTGCTTTCACAG
CTGAATCCGTCGGTAATATCTATGTTCAAGGTCATGAAGACGAAATGTTGGTACAGGAGTTTGAGCACAT
TGTGACGGTGCCTACCGATCCTCAATCCGGCCAGCCTTCCGGCCAACGTGCGCACAAACCATTGCGTTTC
ACTGTTGCGTACAACAAAGCCGTTCCATTGCTGTATAACGCATTAGCCTCTGGTGAAATGCTGCCAACAG
TGGAATTGAAGTGGTACCGCACCTCGATTGAAGGCAAACAAGAGCATTTCTTCACGACTAAACTGGAAGA
TGCCACCATTATCGACATTGATTGTAAAATGCCGCATTGTCAGGATTCCACCAAGGCTGAGTTTACTCAA
TTAGTCCGTGTATCACTGGCATACCGCAAGATTAACTGGGATCACACCACCGCGGGCACCTCTGGTGCTG
ATGACTGGCGTGCGCCGATCGAAGCGTAA