SecReT6
Effector Protein ID: 222157505
-
SecReT6 ID796
T6SS typeA2
Gene symbol-
Locus tagLF82_431
StrainEscherichia coli LF82
Repliconchromosome [GenBank: NC_011993] [Browse all T6SS(s) in this replicon]
Location [Strand]2932245..2932736 [+]
ProductSecreted protein Hcp
Effector typeProtein
Homologous effectorHcp
DescriptionHcp protein
UniProt IDE2QQR5
KEGG IDelf:LF82_431
PDB IDNA
Domain hit(s) vs Pfam DUF796 [PF05638], Evalue: 1.90E-39, Aligned region: 6..147
Protein Sequence: 163 a.a.     [Download]
>gi|222157505|ref|YP_002557644.1| Secreted protein Hcp [Escherichia coli LF82]
MAIPAYLWLKDDGGADIKGSVDVQGREGSIEVVALDHDVYIPTDNNTGKLTGTRTHKPFTFTKEIDASSP
YLYKAVTTGQTLKTAEFKFYRINDAGQEVEYFNITLDNVKLVRVAPLMHDIKDPSREKHNHLERIEFRYE
KITWTYKDGNIIHSDSWNERPSA
-
Nucleotide Sequence: 492 bp     [Download]
>gi|222154829|ref|NC_011993.1|:2932245-2932736 Escherichia coli LF82, complete genome
ATGGCTATTCCTGCTTATCTCTGGCTGAAAGATGACGGCGGCGCGGATATCAAAGGTTCCGTGGACGTTC
AGGGGCGCGAAGGTAGCATCGAAGTGGTGGCGCTGGATCACGATGTGTACATCCCGACCGACAATAACAC
CGGCAAACTGACCGGTACCCGTACTCACAAGCCTTTTACGTTTACCAAAGAAATCGATGCGTCCAGCCCG
TATCTCTACAAAGCTGTGACCACCGGACAGACCCTGAAAACGGCAGAATTTAAGTTTTACCGCATCAACG
ATGCCGGTCAGGAAGTGGAGTACTTCAACATCACGCTTGATAACGTCAAGCTGGTCAGAGTCGCTCCGCT
TATGCACGACATCAAGGATCCTTCCAGAGAGAAGCATAACCACCTGGAACGTATTGAGTTCCGCTACGAG
AAAATCACCTGGACTTACAAAGACGGCAACATCATTCATTCCGACTCGTGGAATGAGCGTCCTTCCGCCT
GA