SecReT6
Effector Protein ID: 224582118
-
SecReT6 ID330
T6SS typeA3
Gene symbol-
Locus tagSPC_0287
StrainSalmonella enterica subsp. enterica serovar Paratyphi C strain RKS4594
Repliconchromosome [GenBank: NC_012125] [Browse all T6SS(s) in this replicon]
Location [Strand]313193..313678 [+]
Producthypothetical protein
Effector typeProtein
Homologous effectorSciK
DescriptionHcp protein
UniProt IDC0Q6P6
KEGG IDsei:SPC_0287
PDB IDNA
Domain hit(s) vs Pfam DUF796 [PF05638], Evalue: 1.10E-40, Aligned region: 6..136
Protein Sequence: 161 a.a.     [Download]
>gi|224582118|ref|YP_002635916.1| hypothetical protein SPC_0287 [Salmonella enterica subsp. enterica serovar Paratyphi C strain RKS4594]
MAYDIFLKIDGIDGESMDDKHKNEIEVLGWRWNIHQESTMHAGSGLGSGKVSVTNLEFEHYIDRASPNLF
KYCASGKHIPQAILVMRKAGGNPLEYLKYTFTDLIVAVVSPSGNREGEIASRERIELSFSTVKQEYVVQN
QQGGSGGTITAGYDFKANKEI
-
Nucleotide Sequence: 486 bp     [Download]
>gi|224581838|ref|NC_012125.1|:313193-313678 Salmonella enterica subsp. enterica serovar Paratyphi C strain RKS4594 chromosome, complete genome
ATGGCTTATGACATTTTTTTGAAAATTGACGGCATTGACGGCGAGTCAATGGATGACAAACACAAAAATG
AAATTGAAGTACTGGGCTGGCGCTGGAATATTCATCAGGAATCCACCATGCACGCCGGTAGTGGCCTCGG
CTCCGGTAAGGTCTCTGTCACTAATCTGGAATTCGAGCATTATATCGATCGCGCCAGCCCGAATCTGTTC
AAATACTGTGCCTCCGGTAAGCACATTCCGCAGGCCATTCTGGTTATGCGTAAGGCTGGCGGCAACCCGT
TGGAGTACCTCAAGTACACCTTTACCGATCTGATCGTTGCGGTCGTTTCACCTAGCGGTAACAGAGAAGG
CGAAATCGCGTCTCGCGAGCGGATTGAGCTCTCCTTCAGCACCGTGAAGCAGGAATACGTGGTGCAGAAC
CAGCAGGGTGGCAGCGGCGGCACCATCACCGCAGGCTACGACTTCAAGGCCAACAAAGAAATTTAA