SecReT6
Effector Protein ID: 224583136
-
SecReT6 ID330
T6SS typeA3
Gene symbol-
Locus tagSPC_1330
StrainSalmonella enterica subsp. enterica serovar Paratyphi C strain RKS4594
Repliconchromosome [GenBank: NC_012125] [Browse all T6SS(s) in this replicon]
Location [Strand]1392931..1393332 [-]
Producthypothetical protein
Effector typeProtein
Homologous effectorSTY2606
DescriptionTae3_TY
UniProt IDC0PZY9
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam CHAP [PF05257], Evalue: 0.00012, Aligned region: 28..99
Protein Sequence: 133 a.a.     [Download]
>gi|224583136|ref|YP_002636934.1| hypothetical protein SPC_1330 [Salmonella enterica subsp. enterica serovar Paratyphi C strain RKS4594]
MLLRILLTGIIMSWDKRMAVNYAKTHAGSHSQGRCAEFTRKAIQAGGITLGHTYHAKDYGPMLRSAGFTA
IGTYEMPREGDVIIIQPYAGGNPSGHMAIYDGAEWYSDFKQRDMWAGPGYRAARPSYTIYRKN
-
Nucleotide Sequence: 402 bp     [Download]
>gi|224581838|ref|NC_012125.1|:c1393332-1392931 Salmonella enterica subsp. enterica serovar Paratyphi C strain RKS4594 chromosome, complete genome
TTGCTATTACGTATTTTATTAACAGGAATCATTATGAGTTGGGATAAAAGAATGGCGGTTAATTATGCCA
AAACGCATGCAGGTTCTCATTCTCAAGGCCGGTGTGCGGAATTTACCCGAAAGGCAATTCAGGCGGGCGG
TATCACGCTGGGGCATACATATCATGCGAAAGATTATGGCCCAATGTTAAGAAGCGCCGGATTCACCGCT
ATTGGTACCTATGAAATGCCGCGCGAGGGTGACGTCATCATTATTCAACCTTACGCTGGCGGAAACCCGA
GCGGTCACATGGCGATATACGATGGCGCAGAGTGGTATTCAGATTTTAAACAACGCGATATGTGGGCCGG
CCCGGGCTACCGGGCAGCCAGGCCCTCATATACCATCTACAGGAAGAATTAA