SecReT6
Effector Protein ID: 224584925
-
SecReT6 ID330
T6SS typeA3
Gene symbol-
Locus tagSPC_3198
StrainSalmonella enterica subsp. enterica serovar Paratyphi C strain RKS4594
Repliconchromosome [GenBank: NC_012125] [Browse all T6SS(s) in this replicon]
Location [Strand]3228676..3229161 [-]
Producthypothetical protein
Effector typeProtein
Homologous effectorHcp
DescriptionHcp protein
UniProt IDC0PYA9
KEGG IDsei:SPC_3198
PDB IDNA
Domain hit(s) vs Pfam DUF796 [PF05638], Evalue: 2.10E-38, Aligned region: 5..135
Protein Sequence: 161 a.a.     [Download]
>gi|224584925|ref|YP_002638724.1| hypothetical protein SPC_3198 [Salmonella enterica subsp. enterica serovar Paratyphi C strain RKS4594]
MDAIFLKLDNIKGESQVEGFEDQIEIMSYSHNVAMQVNNDVSLTERTSGRAHVGEMSLTKFVDLATPVLN
EYCCSGRLIRTAVLTLCRNDDGKMRSLIVYTLTNVLISQLSVSGGAGGKPVETMSLNFTKIEWQVTAEKS
DGAQQESRASVWDLAMDQIGK
-
Nucleotide Sequence: 486 bp     [Download]
>gi|224581838|ref|NC_012125.1|:c3229161-3228676 Salmonella enterica subsp. enterica serovar Paratyphi C strain RKS4594 chromosome, complete genome
ATGGATGCGATTTTTTTAAAGCTCGACAATATCAAAGGCGAAAGCCAGGTTGAAGGCTTTGAAGATCAGA
TAGAGATCATGTCTTATAGCCACAATGTGGCAATGCAGGTAAATAACGATGTTAGCCTCACTGAGCGGAC
TTCCGGGCGTGCGCATGTTGGTGAAATGTCGCTCACCAAATTTGTCGACCTCGCCACGCCTGTGCTCAAT
GAGTACTGCTGTAGCGGGAGGCTAATTAGAACAGCGGTGCTGACGTTGTGCCGCAATGACGACGGCAAAA
TGCGGTCGCTTATCGTTTATACCCTGACAAACGTGCTGATATCACAACTCAGTGTTAGCGGCGGCGCCGG
CGGTAAGCCGGTGGAAACGATGTCGCTGAACTTCACGAAAATCGAATGGCAAGTCACTGCCGAGAAATCA
GACGGCGCTCAACAGGAGTCCAGAGCGTCAGTATGGGATCTGGCGATGGACCAGATAGGGAAATGA