SecReT6
Effector Protein ID: 227081586
hcp-1
SecReT6 ID335
T6SS typeA1
Gene symbolhcp-1
Locus tagVCM66_1370
StrainVibrio cholerae M66-2
Repliconchromosome II [GenBank: NC_012578] [Browse all T6SS(s) in this replicon]
Location [Strand]1467074..1467592 [+]
Producthcp protein
Effector typeProtein
Homologous effectorABG57132
DescriptionHcp protein
UniProt IDC3LMB0
KEGG IDvcm:VCM66_1370, vcm:VCM66_A0016
PDB IDNA
Domain hit(s) vs Pfam DUF796 [PF05638], Evalue: 9.30E-38, Aligned region: 6..155
Protein Sequence: 172 a.a.     [Download]
>gi|227081586|ref|YP_002810137.1| hcp protein [Vibrio cholerae M66-2]
MPTPCYISIEGQTQGLITAGACTADSIGDSFVEGHEDEMLVQQFDHVVTVPTDPQSGQPSGQRVHKPFKF
TVALNKAVPLLYNALSSGEKLKTVELKWYRTSIEGKQENFFTTKLENASIVDIHCEMPHCQDPAKSDFTQ
NVTVSLSYRKITWDHVNAGTSGSDDWRKPIEA
-
Nucleotide Sequence: 519 bp     [Download]
>gi|227080237|ref|NC_012578.1|:1467074-1467592 Vibrio cholerae M66-2 chromosome I, complete sequence
ATGCCAACTCCATGTTATATCTCTATCGAAGGCCAAACTCAGGGTCTTATCACTGCAGGTGCATGTACTG
CTGACTCTATCGGCGATTCATTCGTTGAAGGCCACGAAGATGAGATGCTGGTTCAGCAGTTTGACCACGT
TGTGACTGTACCGACTGACCCACAATCTGGTCAGCCTTCAGGCCAACGTGTGCACAAGCCATTCAAATTC
ACTGTGGCGCTGAACAAAGCGGTTCCTCTGCTGTACAACGCGCTCTCTTCTGGTGAGAAGCTGAAAACCG
TTGAGCTGAAGTGGTACCGTACCTCTATCGAAGGTAAACAAGAGAACTTCTTCACCACTAAGCTGGAAAA
CGCGTCTATCGTCGACATCCACTGTGAAATGCCACACTGCCAAGACCCAGCAAAATCTGACTTTACTCAG
AATGTGACTGTGTCTCTGTCTTACCGCAAAATCACTTGGGACCACGTTAACGCGGGCACCTCAGGCTCTG
ATGACTGGCGTAAGCCAATCGAAGCGTAA