SecReT6
Effector Protein ID: 227081587
vgrG-1
SecReT6 ID335
T6SS typeA1
Gene symbolvgrG-1
Locus tagVCM66_1371
StrainVibrio cholerae M66-2
Repliconchromosome II [GenBank: NC_012578] [Browse all T6SS(s) in this replicon]
Location [Strand]1467720..1471211 [+]
ProductvgrG protein
Effector typeProtein
Homologous effectorVC1416
Descriptiontype VI secretion system Vgr family protein
UniProt IDC3LMB1
KEGG IDvcm:VCM66_1371
PDB IDNA
Domain hit(s) vs Pfam Phage_GPD [PF05954], Evalue: 1.80E-64, Aligned region: 42..335
Phage_base_V [PF04717], Evalue: 6.90E-24, Aligned region: 208..226
Phage_base_V [PF04717], Evalue: 6.90E-24, Aligned region: 374..467
Protein Sequence: 1163 a.a.     [Download]
>gi|227081587|ref|YP_002810138.1| vgrG protein [Vibrio cholerae M66-2]
MATLAYSIEVEGLEDETLVVRGFHGQESLSNSVFLGQACYGFRYEVQLASRVSNLTAEQMVDKRAELKLY
RNSQLVQRVHGIVRAFSQGDIGHHHTFYQLTLVPALERLSLRHNSRIFQKQTVPEILSILLQEMGINDYA
FALKRDGVQREFCVQYRESDIDFLHRLAAEEGLVYSFVHEAGKHTLYFSDASDSLSKLPEPIPYNALVGG
AIDTPYIHGLTYRTQAEVSEVQLKDYSFKKPAYSFLQTVQGTELDYQQTRYQHFDAPGRYKDDVNGAAFS
QIRLDYLRRHAHTATGQSNEPLLRAGYKFDLQEHLDPAMNRDWVVVSINHQGEQPQALQEDGGSGATTYS
NQFSLIPGHLHWRAEPQPKPQVDGPMIATVVGPEGEEIFCDEHGRVKIHFPWDRYSNGNEQSSCWVRVSQ
GWAGSQYGFIAIPRIGHEVIVEFLNGDPDQPIITGRTYHATNTPPYTLPEHKTKTVLRTETHQGEGFNEL
SFEDQAGKEQIYLHAQKDFDGLIENDHTTVIRHDHHLTVENDQFTQIKHNQHLTVEWESREAVTGEQVLS
IEGSLHVKTGKVWVNEAGTEIHVKAGQKVVIEAGSEITVKAGGSFVKVDPAGVHLSGALVNLNSGGSAGS
GSGFGGAMPALPGGLEPAVALAPPQTISYQALLQAEQANVPAVKVCPLAAQEATPAVNSITPPPPPPIAP
PMAPPQPIMNPQPTANAQPNLGRSTKATPDFPTHFPKSSIGIENELAGLVVAMPANSAQKFGYVKSAQGD
ALFMLTKDMNQGSYQRPPSLQDGKNYQNWQTHTVELVSYPCEMDDKAAVETRKQAMLWLATHFTTHIDQS
NHQPLAPIQSEDGRFVIEITNAKHVIAAGNGISAESQGQTITMTPSGQQATVGVAAKGFGTSATPELRLL
ESAPWYQKSLKSQFASLTSAENLDDKELAANVFAYLTSIYLKTAELAKKFGIYINEWDPMSEQITPNANG
LTDPKVKNAWEILPRTKPSKIVEILSKSDAKAVMKHIKPQLQSRYSESLSKNVFQYFQDGGEVAGHGINN
ATVGDKHSPELAILFEFRTVPNELQSYLPKTESTTKSEVKLLDQFDPMKRKTVIQQVESLVQNSGDAFDK
WYQSYRDSMNQPPVKNAKKIASANQKAQWVKEHNPQEWQRIIA
-
Nucleotide Sequence: 3492 bp     [Download]
>gi|227080237|ref|NC_012578.1|:1467720-1471211 Vibrio cholerae M66-2 chromosome I, complete sequence
ATGGCGACATTAGCGTACAGCATTGAGGTGGAAGGGCTGGAAGATGAGACTCTGGTGGTCAGAGGCTTCC
ACGGGCAGGAGTCACTCTCTAATAGTGTTTTTTTAGGGCAAGCCTGTTACGGGTTTCGCTACGAAGTGCA
ACTGGCGAGTCGGGTATCAAACCTCACCGCCGAGCAGATGGTGGATAAGCGTGCCGAGCTCAAGCTTTAC
CGCAACTCACAGTTGGTGCAGCGCGTGCACGGCATTGTGCGTGCTTTCAGCCAAGGCGATATCGGCCATC
ACCACACCTTCTACCAACTCACTTTAGTCCCTGCCTTAGAGCGCTTATCCCTGCGTCATAACAGCCGCAT
TTTCCAAAAGCAGACTGTCCCTGAGATTCTCTCTATCTTGCTGCAAGAGATGGGCATCAACGATTACGCT
TTTGCGCTCAAACGTGATGGCGTGCAGCGTGAGTTTTGTGTGCAGTACCGCGAAAGCGATATCGACTTTC
TGCACCGCCTCGCCGCTGAAGAAGGTTTGGTGTACAGCTTTGTCCATGAAGCGGGCAAACATACCCTCTA
TTTCAGTGATGCCAGTGATAGCCTAAGCAAACTGCCGGAGCCTATCCCATACAACGCTTTAGTCGGTGGC
GCGATAGATACCCCGTATATCCACGGCTTAACCTATCGCACCCAAGCAGAAGTGAGCGAAGTTCAGCTCA
AAGACTACAGCTTCAAAAAGCCAGCCTACTCCTTTTTGCAAACCGTGCAGGGTACTGAGCTGGATTATCA
GCAAACGCGCTACCAACATTTTGATGCGCCGGGGCGCTACAAAGACGATGTGAACGGCGCCGCCTTTAGC
CAAATCCGTTTAGACTACCTGCGCCGCCATGCCCATACCGCAACAGGGCAGAGCAACGAGCCGCTGCTGC
GTGCCGGCTATAAGTTTGACCTGCAAGAGCACCTTGACCCCGCGATGAACCGCGATTGGGTGGTAGTGTC
GATTAACCACCAAGGTGAGCAGCCGCAAGCGCTACAAGAAGACGGTGGCAGCGGCGCTACTACTTACAGC
AATCAGTTCAGCTTAATTCCGGGGCATCTTCACTGGCGCGCCGAGCCACAACCCAAACCGCAAGTCGATG
GTCCAATGATTGCCACGGTCGTCGGTCCTGAAGGCGAAGAAATCTTCTGTGATGAACATGGGCGGGTGAA
AATCCATTTCCCGTGGGACCGTTACTCGAACGGTAACGAGCAAAGCTCCTGTTGGGTACGGGTGTCGCAA
GGTTGGGCGGGCAGTCAGTATGGCTTTATCGCTATTCCGCGCATCGGCCATGAAGTGATTGTAGAGTTTT
TAAACGGTGACCCAGACCAACCGATTATCACTGGCCGCACTTATCATGCGACCAACACGCCGCCATACAC
CTTGCCTGAGCACAAAACCAAAACCGTGCTGCGCACCGAGACGCACCAAGGGGAGGGCTTTAACGAGCTC
AGTTTTGAAGACCAAGCGGGCAAAGAGCAAATCTACCTGCATGCGCAGAAAGATTTTGATGGTTTGATTG
AAAACGACCACACCACGGTCATTCGTCACGACCATCACCTGACCGTTGAAAACGACCAATTTACCCAGAT
TAAGCACAACCAACACCTGACGGTGGAGTGGGAAAGTCGAGAAGCGGTAACGGGCGAGCAAGTGCTGAGT
ATTGAAGGCTCGCTGCATGTGAAAACAGGCAAAGTTTGGGTCAATGAAGCGGGTACAGAGATCCATGTAA
AAGCGGGACAGAAAGTGGTGATTGAAGCGGGCTCCGAGATTACCGTTAAAGCGGGCGGCAGCTTTGTGAA
AGTCGATCCGGCTGGGGTGCATCTGTCCGGTGCTTTGGTCAATCTCAACTCTGGCGGCAGCGCTGGTAGT
GGTAGCGGCTTTGGCGGTGCAATGCCCGCCTTACCGGGCGGCTTAGAACCCGCCGTGGCACTGGCTCCAC
CGCAAACCATCTCTTACCAAGCGTTGCTACAGGCCGAGCAAGCGAATGTTCCTGCGGTGAAGGTGTGTCC
TTTAGCCGCTCAAGAAGCAACGCCTGCGGTGAATAGTATCACGCCGCCTCCACCACCACCGATTGCTCCG
CCAATGGCCCCACCACAACCAATAATGAATCCACAGCCAACCGCTAACGCGCAGCCTAATCTTGGAAGAT
CCACTAAGGCAACGCCGGATTTTCCAACACATTTCCCGAAGTCATCCATTGGCATTGAGAATGAGTTAGC
TGGTCTAGTGGTGGCTATGCCAGCCAACTCGGCACAGAAATTTGGCTACGTGAAAAGTGCACAAGGTGAT
GCGCTGTTTATGTTAACGAAAGACATGAACCAAGGTTCGTATCAGCGGCCACCTTCATTACAAGATGGAA
AAAATTATCAGAATTGGCAGACGCATACAGTAGAGTTGGTGAGCTACCCTTGTGAAATGGACGATAAAGC
TGCCGTTGAAACACGCAAACAAGCCATGTTGTGGTTAGCAACCCACTTTACTACGCATATCGACCAGTCC
AATCATCAACCATTAGCTCCTATTCAAAGTGAAGACGGACGCTTTGTTATCGAAATCACTAATGCGAAGC
ATGTGATTGCTGCGGGCAATGGGATTTCTGCAGAATCTCAAGGTCAAACAATCACGATGACACCAAGTGG
ACAACAAGCCACAGTGGGTGTTGCTGCTAAAGGTTTCGGGACGAGTGCAACGCCAGAATTAAGGTTACTT
GAATCGGCACCTTGGTATCAGAAATCACTCAAGAGCCAATTTGCATCTCTAACGAGCGCAGAAAACTTGG
ATGATAAAGAGTTAGCTGCAAACGTATTTGCTTATCTGACGTCTATTTATTTAAAAACAGCAGAGCTAGC
GAAGAAGTTTGGTATTTACATCAATGAATGGGACCCCATGTCGGAGCAAATTACTCCAAATGCGAATGGA
TTAACGGATCCAAAAGTAAAAAATGCATGGGAAATATTGCCACGTACAAAACCAAGCAAAATAGTAGAAA
TACTCAGTAAGAGTGATGCCAAAGCGGTTATGAAACATATCAAGCCTCAATTGCAGTCTCGCTATTCTGA
GAGTTTGTCGAAAAATGTATTTCAATATTTCCAAGATGGTGGTGAAGTAGCCGGACACGGTATTAATAAT
GCGACGGTCGGTGATAAACATAGTCCGGAATTGGCGATTTTGTTTGAGTTCAGAACTGTTCCGAATGAAC
TGCAAAGTTATTTGCCTAAAACAGAATCGACAACTAAGTCAGAAGTGAAGTTACTCGATCAGTTTGATCC
TATGAAGCGTAAAACAGTAATTCAACAAGTAGAATCGCTTGTGCAAAATAGTGGCGATGCATTTGATAAA
TGGTACCAAAGCTACCGAGACTCCATGAATCAACCTCCCGTTAAAAATGCGAAGAAAATTGCTTCCGCGA
ATCAAAAAGCACAATGGGTTAAAGAGCATAATCCTCAAGAATGGCAACGCATTATTGCTTAG