SecReT6
Effector Protein ID: 227081589
-
SecReT6 ID335
T6SS typeA1
Gene symbol-
Locus tagVCM66_1373
StrainVibrio cholerae M66-2
Repliconchromosome II [GenBank: NC_012578] [Browse all T6SS(s) in this replicon]
Location [Strand]1472053..1473978 [+]
Producthypothetical protein
Effector typeProtein
Homologous effectorVC1418
DescriptionTseL
UniProt IDC3LMB3
KEGG IDvcm:VCM66_1373
PDB IDNA
Domain hit(s) vs Pfam Lipase_3 [PF01764], Evalue: 1.20E-22, Aligned region: 319..434
CarboxypepD_reg [PF13620], Evalue: 0.0047, Aligned region: 23..88
Protein Sequence: 641 a.a.     [Download]
>gi|227081589|ref|YP_002810140.1| hypothetical protein VCM66_1373 [Vibrio cholerae M66-2]
MDSFNYCVQCNPEENWLELEFRSENDEPIDGLLVTITNQSAPSNTYTQTTSSGKVLFGKIAAGEWRASVS
QASLLTEVEKYASRKEGQESPVKKRAAAELDAADKDTKQYRFTTIGDFWDEAPKDEFLQKQHKGIDVNAS
AEKAGFRLSHNQTYVFEIKALRSYMPVIIDTDEFNLVNSYTFALLSKLAYATNDFNRDDGKTIDNQGAIS
TVISQLKRKERPTYSGDLQAKWLLEEIPYSKALSAQYYAEDDVGSEGYIIFNDELAIIGVRGTEPYFQSK
KPPVDNTKFKIIKAASGMAAVIADKIESATDSPGMKDLIITDLDAAQIAPEEFGGTYVHRGFYQYTMALL
SLMEKDLGLHKIKKFYCCGHSLGGAGALLISALIKDSYHPPVLRLYTYGMPRVGTRSFVERYQNILHYRH
VNNHDLVPQIPTVWMNTDVSEGFHVLDVFKSRVDLMRKMLTDDDDDNYQHHGHLSQLLTYNSNNQVLLTP
KQTQVTMLDLANLATNDSVAMVDGLSDASIVEHGMEQYIPNLFEQLTALSDESLMVHYQRAISALEQEIA
TLQQSYLTVKQAWIESIGNGTPTMNIGRLMSEMHSINKLIENRNKIRGELRQIVSDPQRMPATKFLISQQ
TLPDEIKVQIR
-
Nucleotide Sequence: 1926 bp     [Download]
>gi|227080237|ref|NC_012578.1|:1472053-1473978 Vibrio cholerae M66-2 chromosome I, complete sequence
ATGGATTCATTTAATTATTGCGTGCAGTGTAACCCTGAGGAAAACTGGTTAGAGCTAGAGTTTCGGAGTG
AAAATGATGAACCGATAGATGGTTTGCTAGTTACGATTACGAACCAAAGTGCCCCCTCTAACACATACAC
GCAAACCACAAGTTCGGGTAAGGTGTTGTTTGGCAAGATTGCGGCTGGGGAATGGCGTGCTTCTGTAAGC
CAAGCTTCTCTGTTAACTGAAGTCGAAAAATATGCCAGCCGTAAAGAGGGACAAGAGTCGCCAGTGAAAA
AACGAGCTGCGGCAGAACTTGACGCCGCAGATAAAGATACGAAGCAGTACCGCTTTACCACTATTGGTGA
TTTCTGGGATGAAGCACCAAAAGATGAGTTTTTACAAAAGCAGCATAAAGGGATAGATGTCAATGCTTCT
GCTGAGAAAGCAGGGTTTAGACTCAGTCATAACCAGACCTATGTTTTTGAAATCAAAGCACTACGTAGCT
ATATGCCAGTGATTATTGATACCGATGAATTTAACTTGGTGAATAGTTATACCTTTGCGTTGTTGTCGAA
ATTAGCTTATGCGACTAACGATTTTAATAGGGATGATGGTAAGACAATAGATAATCAGGGAGCAATTAGC
ACGGTTATTTCTCAATTGAAGCGTAAAGAAAGACCGACTTATTCTGGAGATTTACAAGCAAAGTGGTTAT
TAGAGGAAATTCCATATAGCAAAGCGTTAAGTGCCCAATATTATGCTGAGGATGATGTCGGTAGTGAAGG
TTACATCATCTTTAACGATGAATTGGCGATTATAGGTGTGAGAGGTACAGAGCCTTATTTTCAGAGTAAG
AAACCACCTGTTGATAACACTAAATTTAAAATTATAAAAGCGGCTTCAGGTATGGCGGCTGTGATTGCGG
ATAAGATAGAAAGTGCTACCGATTCACCAGGAATGAAAGACCTTATTATAACAGACCTTGATGCTGCGCA
AATCGCCCCCGAAGAGTTTGGTGGAACATATGTTCATCGGGGGTTTTACCAATATACGATGGCTTTGTTA
TCTTTGATGGAGAAAGATCTAGGGCTACATAAAATAAAAAAATTCTATTGTTGTGGCCATAGCTTAGGGG
GCGCTGGTGCATTACTTATAAGTGCATTGATTAAAGATAGCTATCATCCTCCAGTATTGCGTTTATATAC
ATATGGAATGCCACGAGTGGGAACTCGCAGTTTTGTAGAGCGCTATCAAAATATTTTGCATTACCGTCAT
GTTAATAATCACGATTTGGTGCCACAGATACCAACAGTATGGATGAACACAGATGTATCTGAAGGATTCC
ATGTACTTGATGTATTTAAAAGCCGTGTTGATCTGATGAGAAAAATGCTCACTGATGATGATGATGACAA
TTATCAACACCATGGTCATTTGTCTCAGTTACTAACTTATAATTCAAATAACCAAGTCTTACTGACACCC
AAACAAACTCAAGTCACTATGCTAGACCTAGCAAATTTAGCCACTAATGATTCTGTTGCTATGGTAGATG
GTTTATCAGATGCCTCAATAGTAGAGCATGGAATGGAGCAGTATATACCCAATTTATTTGAGCAGTTAAC
AGCACTAAGTGATGAAAGTTTAATGGTGCATTATCAACGAGCGATTTCAGCCTTAGAGCAGGAAATTGCT
ACGTTGCAACAAAGTTATCTTACAGTTAAACAAGCTTGGATTGAATCTATAGGAAATGGCACGCCGACTA
TGAATATCGGACGTTTGATGAGTGAAATGCATTCTATAAATAAATTAATAGAGAACCGTAATAAAATTAG
AGGTGAGCTAAGGCAGATAGTCTCTGATCCTCAGCGTATGCCTGCAACTAAATTTTTAATTTCACAGCAA
ACCTTACCAGATGAAATCAAGGTGCAAATAAGATGA